DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and ILKAP

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:372 Identity:80/372 - (21%)
Similarity:133/372 - (35%) Gaps:105/372 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRALRSSFSTLLETATGGGSGAAAKGATKSGATPGSSGAPRPRFV---SVVCGFAKDNLRHKYKP 74
            |.:|.:|.|.:::|     .|..||..|......||......:..   ||:.|.      ..|..
Human    59 SGSLATSISQMVKT-----EGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGL------KGYVA 112

  Fly    75 GKYGE-DSWFKASTASADV----------------MGVADGVGGWRSYGIDPGEFSSFLMR---- 118
            .:.|| :....|.....|:                ..|.||.||.|:...........|:|    
Human   113 ERKGEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPK 177

  Fly   119 ----TCERLV-QCSHFNPQRPVNLLAYSYCELMEQ---KKPIL--GSSTACVLILNRETSTVHTA 173
                :.|:.| :|.       ::...::..|.::|   :||..  ||:..|||.::   :.::.|
Human   178 GDVISVEKTVKRCL-------LDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVD---NILYIA 232

  Fly   174 NIGDSGFVVVREGQVVHKSEEQQH--------YFNTPFQLSLPPPGHGPNVLSDSPESADTMSFP 230
            |:|||..::.|     :..|.|:|        :..|.::..:.....|.||..........:|..
Human   233 NLGDSRAILCR-----YNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRS 292

  Fly   231 VRDG-----------DV-----------ILIATDGVFD-NVPEDLMLQVLSEVEGERDPVKLQMT 272
            :.||           |:           ||:|.||:|. ..||:.:..:||.:|.|    |:|..
Human   293 IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDE----KIQTR 353

  Fly   273 ANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVVLATV 319
            ....|..||.          .|...|..|...:.|..|::||::..:
Human   354 EGKSAADARY----------EAACNRLANKAVQRGSADNVTVMVVRI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 65/301 (22%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 10/35 (29%)
PP2Cc 108..390 CDD:238083 66/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.