DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ilkap

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:390 Identity:83/390 - (21%)
Similarity:135/390 - (34%) Gaps:131/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATGGGSGA---------AAKGATKSGATPGS-------SGAPRP------------------RF 56
            ::|..|||.         |..|.:.|.||.||       .||.|.                  :.
  Rat    36 SSTDSGSGGPLLFDGLPPAGSGNSGSLATSGSQVVKNEGKGAKRKAPEEEKNGGEELVEKKVCKA 100

  Fly    57 VSVVCGFAKDNLRHKYKPGKYGE-DSWFKASTASADV----------------MGVADGVGGWRS 104
            .||:.|.      ..|...:.|| :....|.....|:                ..|.||.||.|:
  Rat   101 SSVIFGL------KGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRA 159

  Fly   105 YGIDPGEFSSFLMR--------TCERLV-QCSHFNPQRPVNLLAYSYCELMEQ---KKPIL--GS 155
            ...........|:|        :.|:.| :|.       ::...::..|.::|   :||..  ||
  Rat   160 SKFAAQNLHQNLIRKFPKGDVISVEKTVKRCL-------LDTFKHTDEEFLKQASSQKPAWKDGS 217

  Fly   156 STACVLILNRETSTVHTANIGDSGFVVVREGQVVHKSEEQQH--------YFNTPFQLSLPPPGH 212
            :..|||.::   :.::.||:|||..::.|     :..|.|:|        :..|.::..:.....
  Rat   218 TATCVLAVD---NILYIANLGDSRAILCR-----YNEESQKHAALSLSKEHNPTQYEERMRIQKA 274

  Fly   213 GPNVLSDSPESADTMSFPVRDG-----------DV-----------ILIATDGVFD-NVPEDLML 254
            |.||..........:|..:.||           |:           ||:|.||:|. ..||:.:.
  Rat   275 GGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVN 339

  Fly   255 QVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVVLATV 319
            .:||.:|.|    |:|......|:.||.          .|...|..|...:.|..|::||::..:
  Rat   340 FILSCLEDE----KIQTREGKPAVDARY----------EAACNRLANKAVQRGSADNVTVMVVRI 390

  Fly   320  319
              Rat   391  390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 65/301 (22%)
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 14/54 (26%)
PP2Cc 108..390 CDD:238083 66/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.