DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and PPM1A

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_016876870.1 Gene:PPM1A / 5494 HGNCID:9275 Length:459 Species:Homo sapiens


Alignment Length:412 Identity:84/412 - (20%)
Similarity:133/412 - (32%) Gaps:138/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSSFSTLLETATGGGSGAAAKGATKSGATPG--------------SSGA--PRPRFVSVVCGFAK 65
            |.:|..:|..|...|.....|  |||..:.|              ..||  .:|:       ..|
Human    34 RLNFFCVLGCAPSAGKTPVNK--TKSPCSHGVYSHYSKVYLEDQDIMGAFLDKPK-------MEK 89

  Fly    66 DNLRHKYKPGKYGEDS---W-FKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTCERLVQC 126
            .|.:.:....:||..|   | .:...|...|:|:..|:..|..:.:..|...|.:.:.|     |
Human    90 HNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYC-----C 149

  Fly   127 SHF-----------------------NPQRPVNLLAYSYCELMEQKK---PILGSSTACVLILNR 165
            .|.                       |..|...|....:..:|.:||   ...||:...|||   
Human   150 EHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLI--- 211

  Fly   166 ETSTVHT--ANIGDSGFVVVREGQVVHKSEEQQHYFNTPFQLSLP-------------------- 208
              |..||  .|.|||..::.|..:|        |:|....:.|.|                    
Human   212 --SPQHTYFINCGDSRGLLCRNRKV--------HFFTQDHKPSNPLEKERIQNAGGSVMIQRVNG 266

  Fly   209 ---------------PPGHGP--NVLSDSPESADTMSFPVRDGDVILIATDGVFD---------- 246
                           ..|.||  .::|..||..| :.....|...|::|.||::|          
Human   267 SLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHD-IERSEEDDQFIILACDGIWDVMGNEELCDF 330

  Fly   247 -----NVPEDLMLQVLSEV------EGERDPVKLQMTA--NSLALMARTLSLNSEFLSPFALSAR 298
                 .|.:||. :|.:||      :|.||.:.:.:..  |:..:....:...:| |..:.....
Human   331 VRSRLEVTDDLE-KVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAE-LDKYLECRV 393

  Fly   299 RNNIQARGGKPDDITVVLATVA 320
            ...|:.:|....|:..|:.|:|
Human   394 EEIIKKQGEGVPDLVHVMRTLA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 66/331 (20%)
PPM1AXP_016876870.1 PP2Cc 100..368 CDD:238083 60/287 (21%)
PP2C_C 362..437 CDD:285117 9/55 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.