DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and pptc7a

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001007379.1 Gene:pptc7a / 492506 ZFINID:ZDB-GENE-041114-74 Length:297 Species:Danio rerio


Alignment Length:265 Identity:146/265 - (55%)
Similarity:193/265 - (72%) Gaps:2/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VSVVCGFAKDNLRHKYKPGK-YGEDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTC 120
            ||...||.||..:...|.|. ||:|:.|.|...||||:||||||||||.||:||.:||..|||||
Zfish    30 VSASFGFGKDFRKGILKKGMCYGDDACFIARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTC 94

  Fly   121 ERLVQCSHFNPQRPVNLLAYSYCELMEQKKPILGSSTACVLILNRETSTVHTANIGDSGFVVVRE 185
            ||||:...|.|..||.:|..||.||::.|.|:|||||||:::|:|::..:||||:|||||:|||.
Zfish    95 ERLVKEGRFVPSNPVGILTTSYYELLQNKVPLLGSSTACIVVLDRQSHRLHTANLGDSGFLVVRG 159

  Fly   186 GQVVHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPESADTMSFPVRDGDVILIATDGVFDNVPE 250
            |:|||:|:|||||||||||||:.||....:||||||::||:.||.|:.||:||.||||:|||:|:
Zfish   160 GEVVHRSDEQQHYFNTPFQLSIAPPEAEGSVLSDSPDAADSSSFDVQLGDIILTATDGLFDNMPD 224

  Fly   251 DLMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVV 315
            .::||.|.::: ..:....|.||.|:|..|..|:.:..::||||..|..|.:..||||||||||:
Zfish   225 YMILQELKKLK-NTNYESTQQTAKSIAEQAHVLAYDPNYMSPFAQFACDNGLNVRGGKPDDITVL 288

  Fly   316 LATVA 320
            |:.||
Zfish   289 LSIVA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 135/240 (56%)
pptc7aNP_001007379.1 PP2Cc 53..289 CDD:381813 133/236 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578462
Domainoid 1 1.000 263 1.000 Domainoid score I1886
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 291 1.000 Inparanoid score I2774
OMA 1 1.010 - - QHG56397
OrthoDB 1 1.010 - - D546690at33208
OrthoFinder 1 1.000 - - FOG0002449
OrthoInspector 1 1.000 - - mtm6518
orthoMCL 1 0.900 - - OOG6_100742
Panther 1 1.100 - - LDO PTHR12320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2170
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.