DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and alph

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster


Alignment Length:249 Identity:44/249 - (17%)
Similarity:91/249 - (36%) Gaps:74/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTC-----ERLVQCSHFNPQRPVNLL 138
            ||:::..:       |:.|.:..|..:.:..|.....:...|     |.::....|.....|..:
  Fly    37 EDAYYARA-------GLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGI 94

  Fly   139 AYSYCELMEQKKPI---------LGSSTA-CVLILNRETSTVHTANIGDSGFVVVREGQVV---- 189
            ...:..:.|..:.:         .|.:|| |..:   ..:.|:.||.|||..|:.|:|..|    
  Fly    95 RTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFV---GLTQVYIANCGDSRAVLCRQGVPVFATQ 156

  Fly   190 -HK---SEEQQHYFNTPFQL---------------------SLPPPGHGPNVLSDSPE-----SA 224
             ||   .||::..:|....:                     ::...|....::|..||     ..
  Fly   157 DHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQ 221

  Fly   225 DTMSFPVRDGDVILIATDGVFDNVPEDLMLQVLSEVEGERDPVKLQMTANSLAL 278
            |:..|       :::|.||::|.:..:   .|.|.:..     ::::|:|.:::
  Fly   222 DSDEF-------LVLACDGIWDVMSNE---DVCSFIHS-----RMRVTSNLVSI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 44/249 (18%)
alphNP_651701.1 PP2Cc 24..284 CDD:238083 44/249 (18%)
PP2C_C 278..352 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.