DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and CG6036

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster


Alignment Length:243 Identity:48/243 - (19%)
Similarity:79/243 - (32%) Gaps:86/243 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DGVGGWRSYGIDPGEFSSFLMRTC-----ERLVQCSHFNPQRPVNLLAYSYCELMEQKKPIL--- 153
            |....|..:.:..|...|.:...|     ..:::...|:..:....:...:.:|.|..:.:.   
  Fly    52 DPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRKLYHDQ 116

  Fly   154 --GSSTACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HK---SEEQQHYFNTPFQLSLP 208
              ||:..||.:   ....::..|.|||..|:.|.|..|     ||   .:||:...|.       
  Fly   117 QGGSTAICVFV---SPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNA------- 171

  Fly   209 PPGHGPNVL-----------------------SDSPESADTMSFPVRD---------GDVILIAT 241
                |.:|:                       |.||  .|.|..|..|         .:.|::|.
  Fly   172 ----GGSVMIKRINGTLAVSRAFGDYDFKNDGSKSP--VDQMVSPEPDIIVCNRSEHDEFIVVAC 230

  Fly   242 DGVFD---------------NVPEDLMLQVLSEVE-----GERDPVKL 269
            ||::|               .|..||.:.|.|.::     |.||.:.|
  Fly   231 DGIWDVMTSSEVCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 48/243 (20%)
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 47/240 (20%)
PP2C_C 284..352 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.