DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and ppm1g

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005169569.1 Gene:ppm1g / 368275 ZFINID:ZDB-GENE-030425-4 Length:537 Species:Danio rerio


Alignment Length:160 Identity:32/160 - (20%)
Similarity:63/160 - (39%) Gaps:49/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QKKPILGSSTACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HKSEEQ------------ 195
            :::|...|.|..|:.|.|....: .||.|||..||..:|:.:     ||.|::            
Zfish   319 KEEPGSDSGTTAVVALIRGKQLI-VANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGK 382

  Fly   196 ------------------QHYFNTPFQLSLPPPGHGPNVLSDSPE-SADTMSFPVRDGDVILIAT 241
                              .|::..  ..:||..   ..::|..|: ...|::   .|.:.::||.
Zfish   383 VTMDGRVNGGLNLSRAIGDHFYKR--NKALPAE---EQMISALPDVKVLTLN---DDHEFMVIAC 439

  Fly   242 DGVFDNVPEDLMLQVLSE----VEGERDPV 267
            ||:::.:....::..:||    ..|:.:|:
Zfish   440 DGIWNVMSSQEVIDFVSERMKTESGKNNPL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 32/160 (20%)
ppm1gXP_005169569.1 PP2Cc 24..>109 CDD:214625
PP2Cc <323..502 CDD:238083 31/156 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.