DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ppm1e

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_942068.1 Gene:Ppm1e / 360593 RGDID:735028 Length:750 Species:Rattus norvegicus


Alignment Length:383 Identity:87/383 - (22%)
Similarity:136/383 - (35%) Gaps:128/383 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SWTSRAISRA-----LRSSFST-LLETATGGGSGAAAKGATKSGATPGSSGAPRPRFVSVVCGFA 64
            |:.:.|::||     |:|..|. .:...|.|..|.......|...:..|      :...:.|.:.
  Rat   156 SFLAAALARATSDEVLQSDLSAHCIPKETDGTEGTVEIETVKLARSVFS------KLHEICCNWV 214

  Fly    65 KD-------------------NLRHK--------------YKPGKYGEDSWFKASTASADVMGVA 96
            ||                   |:|.|              :......|.::|          .|.
  Rat   215 KDFPLRRRPQIYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYF----------AVF 269

  Fly    97 DGVGGWRSYGIDPGEFSSFLMRTCERLVQCSHFNPQRPVNLLAYSY---CELMEQK--KPILGSS 156
            ||.|     |:|...::|..:..  .||:...| |..|...|..::   .|...||  :..|...
  Rat   270 DGHG-----GVDAAIYASVHLHV--NLVRQEMF-PHDPAEALCRAFRVTDERFVQKAARESLRCG 326

  Fly   157 TACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HK---SEEQQH---------YF----- 199
            |..|:...| .:.:|.|.:|||..::||:||.|     ||   .:|:|.         :|     
  Rat   327 TTGVVTFIR-GNMLHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRV 390

  Fly   200 NTPFQLS--LPPPGHGPNVLSDSPESADTMSFPVRDG--DVILIATDGVFDNVPEDLMLQVLSE- 259
            |....:|  :....|.|.:..|: :||.|    |.||  |.:::|.||.:|.|..|..::|:|: 
  Rat   391 NGSLSVSRAIGDAEHKPYICGDA-DSAST----VLDGTEDYLILACDGFYDTVNPDEAVKVVSDH 450

  Fly   260 -VEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVVL 316
             .|...|.   .|.|:.|...||.                       .|..|:|||::
  Rat   451 LKENNGDS---SMVAHKLVASARD-----------------------AGSSDNITVIV 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 69/272 (25%)
Ppm1eNP_942068.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..128
7 X 2 AA tandem repeats of P-E 31..44
PP2Cc 227..485 CDD:238083 72/306 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..535
M-inducer_phosp <505..>554 CDD:284119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.