DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and CG10376

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:247 Identity:54/247 - (21%)
Similarity:91/247 - (36%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KYKPGK----------YGEDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTCERLVQ 125
            |.||.|          :||  .::....:....||.||..|..|......:....|....:....
  Fly   166 KNKPRKMEDRCVCLDRFGE--MYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPD 228

  Fly   126 CSHFNPQRPVNLLAYSYC---ELMEQKKPILGSSTACVLILNRETSTVHTANIGDSGFVVV---R 184
            .:.|:|....|....::.   |...|||...|:::.|.||...:   ::.|.:|||..::|   .
  Fly   229 PAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQ---LYIAWVGDSKALLVGKRT 290

  Fly   185 EGQVV--HKSE--EQQHYFNTPFQLSLPPPGH-------------GPNVLSDSPESADTMSFPVR 232
            :.|:|  ||.|  :::....|.....|...|.             |...|.......|.:...:.
  Fly   291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLN 355

  Fly   233 DG-DVILIATDGVFDNVPEDLMLQ------------------VLSEVEGERD 265
            :. |.:::.|||::|:|||.|:::                  :|.|...|||
  Fly   356 EAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 51/242 (21%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 54/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.