DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and CG15035

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:334 Identity:169/334 - (50%)
Similarity:235/334 - (70%) Gaps:24/334 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RAISRALRSSFSTLLETATGGGSGAAAKGATKS--------------GATPGSSGAPR------- 53
            :.::|...:||..|.:.:...|:|:.::...:.              |...|.....|       
  Fly    40 QVLNRLKGASFPELAQNSENIGNGSMSENQNQRLDPMTSAQYTTLGFGNFDGEGDYLRQKNKINI 104

  Fly    54 --PRFVSVVCGFAKDNLRH-KYKPGKYGEDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSSF 115
              ||.|||.||||||::|: :|..||:|||:||.:|:..|.:|||||||||||:||:|||:||..
  Fly   105 QLPRLVSVTCGFAKDHIRYPEYNRGKFGEDAWFMSSSPQACIMGVADGVGGWRNYGVDPGKFSMT 169

  Fly   116 LMRTCERLVQCSHFNPQRPVNLLAYSYCELMEQKKPILGSSTACVLILNRETSTVHTANIGDSGF 180
            |||:|||:.....|.|.||..||..:|.:|::||.||:||.|||:|.|.|:.||::.||||||||
  Fly   170 LMRSCERMSHAPDFKPNRPEILLERAYFDLLDQKCPIVGSCTACILALKRDDSTLYAANIGDSGF 234

  Fly   181 VVVREGQVVHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPESADTMSFPVRDGDVILIATDGVF 245
            :|||.|:||.:|:||||.||||:||:.||||:..:.:||.||||||:.||::.|||||:|||||:
  Fly   235 LVVRSGKVVCRSQEQQHQFNTPYQLASPPPGYDFDAVSDGPESADTIQFPMQLGDVILLATDGVY 299

  Fly   246 DNVPEDLMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPD 310
            |||||..:::||:|:.|..:||:|||.||::||||||||.:.:..|||:.:||:::|.|.|||||
  Fly   300 DNVPESFLVEVLTEMSGISNPVRLQMAANTVALMARTLSFSPKHDSPFSQNARKHDIDAWGGKPD 364

  Fly   311 DITVVLATV 319
            ||||:||:|
  Fly   365 DITVLLASV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 143/239 (60%)
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 141/237 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445857
Domainoid 1 1.000 130 1.000 Domainoid score I1703
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1797
Isobase 1 0.950 - 0 Normalized mean entropy S1764
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D546690at33208
OrthoFinder 1 1.000 - - FOG0002449
OrthoInspector 1 1.000 - - mtm6518
orthoMCL 1 0.900 - - OOG6_100742
Panther 1 1.100 - - P PTHR12320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R127
SonicParanoid 1 1.000 - - X2170
1312.780

Return to query results.
Submit another query.