DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Pp2d1

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:203 Identity:45/203 - (22%)
Similarity:81/203 - (39%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IDPGEFSSFLMRTC-ERLVQCSHFNPQRPVNLLAYSYCELMEQKKP---ILGSSTACVLILNRET 167
            :|.|:..:|....| :.|....:|..::..|.|:....|.|..:||   ::.....|: |.|...
  Rat    86 VDMGDMVTFPCSVCHQELNTAGNFLHKKHHNALSTLGFEWMGGRKPKPKMVSFHRECI-ISNLLR 149

  Fly   168 STVHTANIGDS---GFVVVREGQV------VHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDS--- 220
            |:.::..:..|   .|.::|:.|:      ..|..|...|..|.:.|.:    .|..:.|:|   
  Rat   150 SSTYSEKVLQSMNYAFELLRKKQIPSYFKLCDKVGETSIYSPTSYHLLI----KGIAICSNSNST 210

  Fly   221 ----PESADTMSFPVRD-GDVILIATDGVFDN---------VPEDLMLQVLSEVEGERDPVKLQM 271
                |....|:   |.| ||...:...|:||:         ..::..:.:|.:: ..:|| ..||
  Rat   211 WKAEPNCKFTV---VNDFGDKANVCFFGLFDSHHGYAAADLASKEFQVLLLHQL-SVQDP-SYQM 270

  Fly   272 TANSLALM 279
            ||....|:
  Rat   271 TAEQQDLI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 45/203 (22%)
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.