DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ppm1k

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001101333.1 Gene:Ppm1k / 312381 RGDID:1308501 Length:372 Species:Rattus norvegicus


Alignment Length:298 Identity:58/298 - (19%)
Similarity:101/298 - (33%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GAPRPRFVSVVCGFAKDNLRHKYKPGKYGEDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSS 114
            |.|.|:......|.|....:.|....::|    |...|.......|.||.||..:     .:|..
  Rat    84 GKPIPKISLENVGCASLIGKRKENEDRFG----FAQLTEEVLYFAVYDGHGGPAA-----ADFCH 139

  Fly   115 FLMRTCERLVQCSHFNPQ----RPVNLLAY--------SYCELMEQKKPILGSSTACVLILNRET 167
            ..|..|     .:...|:    ..|..||:        ||..|......:...:||.|.:| |:.
  Rat   140 THMEKC-----VTDLLPREKDLETVLTLAFLEIDKAFSSYAHLSADASLLTSGTTATVALL-RDG 198

  Fly   168 STVHTANIGDSGFVVVREGQVV---------HKSEEQ---------------QHYFNTPF----- 203
            ..:..|::|||..::.|:|:.:         .|.|::               |.:.|...     
  Rat   199 VELVVASVGDSRALLCRKGKPMKLTTDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRS 263

  Fly   204 --QLSLPPPGHGPNVLSDSPESADTMSFPVRDGDVILIATDGVFDNVPEDLML---QVLSEVEGE 263
              .|.|...|    |::: ||:.....:.. |...:::.|||:      :.|:   ::...|...
  Rat   264 IGDLDLKASG----VIAE-PETTRIKLYHA-DDSFLVLTTDGI------NFMVNSQEICDFVNQC 316

  Fly   264 RDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNN 301
            .||.:........|:...|...::..:.||....:..|
  Rat   317 HDPKEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 52/272 (19%)
Ppm1kNP_001101333.1 PP2Cc 95..346 CDD:238083 52/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.