DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and ppm1ab

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001154804.1 Gene:ppm1ab / 30703 ZFINID:ZDB-GENE-991102-14 Length:372 Species:Danio rerio


Alignment Length:281 Identity:56/281 - (19%)
Similarity:94/281 - (33%) Gaps:104/281 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KYGEDS---W-FKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMR-TCERLVQCSHFNP---- 131
            :||..|   | .:...|...|||:..|:|.|..:.:..|...|.:.| .||.|::....||    
Zfish    62 RYGLSSMQGWRVEMEDAHTAVMGLPFGLGLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFRG 126

  Fly   132 ---------------QRPVNLLAYSYCELMEQKKPI---------LGSSTACVLILNRETSTVHT 172
                           :...|.:...:.::.|..:.:         .||:...|:|   .....:.
Zfish   127 GCSIGGDLVGTEPSVESVKNGIRTGFLQIDEHMRAMSERKHGADRSGSTAVGVMI---SPHHFYF 188

  Fly   173 ANIGDSGFVVVREGQVVHKSEEQQHYFNTPFQLSLP----------------------------- 208
            .|.|||..::.|:|:|        |:|....:.|.|                             
Zfish   189 INCGDSRALLSRKGRV--------HFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALG 245

  Fly   209 ------PPGHGP--NVLSDSPESADTMSFPVRDGDVILIATDGVFD---------------NVPE 250
                  ..|.||  .::|..||..:.......| :.:::|.||::|               .|.|
Zfish   246 DFDYKCVHGKGPTEQLVSPEPEVYEIERSEAED-EFVVLACDGIWDVMANEELCDFVRSRLEVTE 309

  Fly   251 DLMLQVLSEV------EGERD 265
            ||. :|.:|:      :|.||
Zfish   310 DLE-RVCNEIVDTCLYKGSRD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 56/281 (20%)
ppm1abNP_001154804.1 PP2Cc 62..338 CDD:238083 56/281 (20%)
PP2C_C 332..>362 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.