DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ppm1f

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_786931.1 Gene:Ppm1f / 287931 RGDID:631363 Length:450 Species:Rattus norvegicus


Alignment Length:385 Identity:90/385 - (23%)
Similarity:134/385 - (34%) Gaps:133/385 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSRAISRALRSSFS---------------------TLLETATGGGSGAAAKGATKS--------- 42
            |..|||:.|::..|                     |||:          |||.::|         
  Rat    79 THEAISQLLQTDLSEFKRLPEQEEEEEEEEERVLTTLLD----------AKGLSRSFFNCLWEVC 133

  Fly    43 ----GATPGSSGAPRPRF-VSVVCGFAKDNLRHKYKPGKYGEDSWFKASTASADVMGVADGVGGW 102
                ...|.::.||:.:: ||:   .|..|.|.|.      ||. ..:..|...:.|::|.|  .
  Rat   134 SQWQKRVPLTAQAPQRKWLVSI---HAIRNTRRKM------EDR-HVSLPAFNHLFGLSDSV--H 186

  Fly   103 RSY--------GIDPGEFSSFLMRTCERLVQCSHFNPQ---RPVNLL--AYSYCE---LMEQKKP 151
            |:|        |:|...::|..:.|     ..|| .|:   .|...|  |:.:.:   |.:.|:.
  Rat   187 RAYFAVFDGHGGVDAARYASVHVHT-----NASH-QPELLTDPAAALKEAFRHTDQMFLQKAKRE 245

  Fly   152 ILGSST--ACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HKSEEQQHYFNTPFQ---LS 206
            .|.|.|  .|.||..   :.:|.|.:|||..::|::||||     ||.|.|.........   :|
  Rat   246 RLQSGTTGVCALITG---AALHVAWLGDSQVILVQQGQVVKLMEPHKPERQDEKSRIEALGGFVS 307

  Fly   207 LPPPGHGPNVLSDSPESADTMSFPVRDG-------------DVILIATDGVFDNVPEDLMLQVLS 258
            |.........|:.|....|....|...|             |.:|:|.||.||.||..   ::..
  Rat   308 LMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRELTGLEDYLLLACDGFFDVVPHH---EIPG 369

  Fly   259 EVEGE--RDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVVL 316
            .|.|.  |........|..|..:||.                       .|..|:|||::
  Rat   370 LVHGHLLRQKGSGMHVAEELVAVARD-----------------------RGSHDNITVMV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 68/280 (24%)
Ppm1fNP_786931.1 PP2C 151..402 CDD:395385 71/297 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.