DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Pdp2

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_659559.2 Gene:Pdp2 / 246311 RGDID:628812 Length:530 Species:Rattus norvegicus


Alignment Length:214 Identity:50/214 - (23%)
Similarity:77/214 - (35%) Gaps:56/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VMGVADGVGGWRSYGIDPGEFSSFLMRTCERLVQCSHFNPQRPVNLLAYSYCELMEQKKPILGSS 156
            ::||....|.|           |.|..||:.               .|::..||...|:....|.
  Rat   291 ILGVQGDNGAW-----------SCLPLTCDH---------------NAWNEAELSRLKREHPESE 329

  Fly   157 TACVLILNRETSTVHTAN-IGDSGFVVVREGQVVHKSEEQQHYFNTPFQLS-------LPPPGHG 213
            ...::|.:|....:.... .||.        |:....|.|::.....|...       .||..|.
  Rat   330 DRTLIIDDRLLGVLLPCRAFGDV--------QLKWSKELQRNVLERGFDTEALNIYQFTPPHYHT 386

  Fly   214 PNVLSDSPESADTMSFPVRDGDVILI-ATDGVFDNVP-EDLMLQV---LSEVEGERDPVKLQMTA 273
            |..|:..||   .....:|..|..|: |:||::|.:. ||::..|   ||:| |.:.|...|..|
  Rat   387 PPYLTAKPE---VTYHRLRPQDKFLVLASDGLWDMLDNEDVVRLVVGHLSKV-GHQKPALDQRPA 447

  Fly   274 N-----SLALMARTLSLNS 287
            |     ||.|..:...|::
  Rat   448 NLGHMQSLLLQRKASGLHA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 50/214 (23%)
Pdp2NP_659559.2 PP2Cc 96..516 CDD:214625 50/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.