DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ppm1b

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001152968.1 Gene:Ppm1b / 19043 MGIID:101841 Length:477 Species:Mus musculus


Alignment Length:316 Identity:60/316 - (18%)
Similarity:105/316 - (33%) Gaps:85/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KYGEDS---W-FKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTCE-RLVQCSHFNPQRPV 135
            :||..|   | .:...|...|:|:..|:..|..:.:..|...|.:...|. .|::  |.......
Mouse    23 RYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLE--HITTNEDF 85

  Fly   136 NLLAYSYCELMEQKKPI-LGSSTACVLI-------------LNRETST----------VHTANIG 176
            .....|...|....:.: .|..|..:.|             ::|..||          ::..|.|
Mouse    86 RAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCG 150

  Fly   177 DSGFVVVREGQVVHKSE--------EQQHYFNTPFQLSLP-------------------PPGHGP 214
            ||..|:.|.|||...::        |::...|....:.:.                   ..|.||
Mouse   151 DSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGP 215

  Fly   215 NVLSDSPESADTMSFPVRDGDVILIATDGVFDNVPEDLM-------LQVLSEVE----------- 261
            .....|||..........:.:.:::|.||::|.:..:.:       |:|..::|           
Mouse   216 TEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCL 280

  Fly   262 --GERD--PVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGK---PD 310
              |.||  .|.|...:|:..:....:..:||.  ...|.:|...|..:.|:   ||
Mouse   281 HKGSRDNMSVVLVCFSNAPKVSEEAVKRDSEL--DKHLESRVEEIMQKSGEEGMPD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 60/316 (19%)
Ppm1bNP_001152968.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PP2Cc 23..295 CDD:238083 51/273 (19%)
PP2C_C 289..365 CDD:369544 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.