DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and Ppm1a

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_036013148.1 Gene:Ppm1a / 19042 MGIID:99878 Length:454 Species:Mus musculus


Alignment Length:418 Identity:87/418 - (20%)
Similarity:129/418 - (30%) Gaps:170/418 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KGATKSG-------ATPG------SSGAPRPRFV-SVVCG-------FAKDNLRHKYKPGKYGED 80
            ||..|.|       .|.|      ....|:|... .|:.|       ..|.|.:.:....:||..
Mouse    35 KGVQKKGRRESRRKQTRGYMKWLWEKQKPKPDLEDQVIMGAFLDKPKMEKHNAQGQGNGLRYGLS 99

  Fly    81 S---W-FKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTCERLVQCSHF------------ 129
            |   | .:...|...|:|:..|:..|..:.:..|...|.:.:.|     |.|.            
Mouse   100 SMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYC-----CEHLLDHITNNQDFRG 159

  Fly   130 -----------NPQRPVNLLAYSYCELMEQKK---PILGSSTACVLILNRETSTVHT--ANIGDS 178
                       |..|...|....:..:|.:||   ...||:...|||     |..||  .|.|||
Mouse   160 SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLI-----SPQHTYFINCGDS 219

  Fly   179 GFVVVREGQVVHKSEEQQHYFNTPFQLSLP----------------------------------- 208
            ..::.|..:|        |:|....:.|.|                                   
Mouse   220 RGLLCRNRKV--------HFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKC 276

  Fly   209 PPGHGP--NVLSDSPESADTMSFPVRDGDVILIATDGVFD---------------NVPEDLMLQV 256
            ..|.||  .::|..||..| :.....|...|::|.||::|               .|.:||. :|
Mouse   277 VHGKGPTEQLVSPEPEVHD-IERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLE-KV 339

  Fly   257 LSEV------EGERD---------PVKLQMTANS----------------------------LAL 278
            .:||      :|.||         |...:::|.:                            |..
Mouse   340 CNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQVEGVPDLVH 404

  Fly   279 MARTL-SLNSEFLSPFA-LSARRNNIQA 304
            :.||| |.|...|.|.. |:::||.|:|
Mouse   405 VMRTLASENIPSLPPGGELASKRNVIEA 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 75/358 (21%)
Ppm1aXP_036013148.1 PP2Cc 95..363 CDD:238083 60/287 (21%)
PP2C_C 357..435 CDD:400262 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.