DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and tap-1

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_510428.1 Gene:tap-1 / 181556 WormBaseID:WBGene00006524 Length:386 Species:Caenorhabditis elegans


Alignment Length:144 Identity:36/144 - (25%)
Similarity:54/144 - (37%) Gaps:47/144 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LNRETSTVHTANIGDSGFVVVREGQVVHKSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPESADTM 227
            :|.||....|..|||.        |..|..||.:.:.|          ..||.|:| :|:...|.
 Worm   198 INPETVLNPTRAIGDL--------QRTHLFEETEAFKN----------AKGPPVIS-TPDVQYTK 243

  Fly   228 SFPVRDGDVILIATDGVFDNVPEDLMLQVLSEVEGERDPVKLQ--------MTANSLALM----- 279
            ..|  ....:::.:|||..|         |.|||.|..|.::.        :|:.:.||:     
 Worm   244 IDP--SWRHLVLISDGVVQN---------LKEVEVENIPTEVSVRLIEDHTVTSTAQALVDSFAR 297

  Fly   280 ----ARTLSLNSEF 289
                |.|:|.:..|
 Worm   298 KHRDAYTMSDDKNF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 36/144 (25%)
tap-1NP_510428.1 PP2Cc 21..327 CDD:238083 36/144 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.