DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12091 and fem-2

DIOPT Version :9

Sequence 1:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:311 Identity:63/311 - (20%)
Similarity:107/311 - (34%) Gaps:124/311 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RHK-------YKPGKY---GEDSWFKASTASADVMGVADGVGG-----------WRSY-----GI 107
            |||       |..|:|   |||        ...|:.|.||.||           |.::     ..
 Worm   172 RHKQEDRFLAYPNGQYMDRGED--------PISVLAVFDGHGGHECSQYAAGHLWETWLEVRKSR 228

  Fly   108 DPGEFSSFLMRTCERLVQCSHFNPQRPVNLLAYSYCELMEQKKPI-------LGSSTACVLILNR 165
            ||.:.....:|                      ...||::::..:       .|.|||....::.
 Worm   229 DPSDSLEDQLR----------------------KSLELLDERMTVRSVKECWKGGSTAVCCAIDM 271

  Fly   166 ETSTVHTANIGDS-GFVV----------------VREGQVVHKSEEQQHYFNTPFQLS------- 206
            :...:..|.:||| |:|:                .||.:.|.::..|........:::       
 Worm   272 DQKLMALAWLGDSPGYVMSNIEFRQLTRGHSPSDEREARRVEEAGGQLFVIGGELRVNGVLNLTR 336

  Fly   207 ----LPPPGHGPNVLSDSPESADTMSFPVRDGD-VILIATDGVFDNVPEDLMLQVLSEVEGERDP 266
                :|    |..::|:.||   |...|:...| ::|:|.||:             |:|..|||.
 Worm   337 ALGDVP----GRPMISNEPE---TCQVPIESSDYLVLLACDGI-------------SDVFNERDL 381

  Fly   267 VKL-QMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDITVVL 316
            .:| :..||...:  ...:..|.|:...|:.|         |..|:::||:
 Worm   382 YQLVEAFANDYPV--EDYAELSRFICTKAIEA---------GSADNVSVVI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 57/295 (19%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 61/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.