DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and lrp10

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_688859.4 Gene:lrp10 / 560361 ZFINID:ZDB-GENE-140418-2 Length:748 Species:Danio rerio


Alignment Length:325 Identity:72/325 - (22%)
Similarity:106/325 - (32%) Gaps:108/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 VDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAATDLC-----ICPTGFKGSRCEIRECHNYCV 407
            |:.:||. .:.||:.::..|||. |..| ..|| .||.|     :|.....|.....:.|..   
Zfish   304 VEVESRT-GLLSLIYRREPVLEG-RGFN-ATYR-ITDYCLPWEELCGGSLGGCYTADQRCDG--- 361

  Fly   408 HGTCQMSELAYPKCY-CQPGF----------KGERCELSVCSGL---CLNGGHCRVSKDENEAPS 458
            |..|..:.|....|: |:.|.          .|.:.|..||...   |....:|....||.|...
Zfish   362 HWDCPETGLDEEACWGCKAGSFLCAMGGIKKAGHQTENPVCYSFHERCNYQLNCPDGTDERECTI 426

  Fly   459 CECPAKF---------------GGARCEQNSTEI-C---------------SLFCRLLKHEPEMY 492
            |: |..|               |...|:..:.|: |               ||.|.||     :.
Zfish   427 CQ-PGTFHCDSDRCVFESWRCDGQVDCKDGTDELNCTATLPRKVITAATVGSLVCGLL-----LV 485

  Fly   493 VPFGC-----------HSICEELAQDNSTNI---AIPQYQHLEVCLTPRVWTSSVIIILVVGIVS 543
            :..||           :|:...:.:..:..|   |.|.|..|                :..||:.
Zfish   486 IAMGCTCKLYSLRTREYSLFAPITRQEAELIQQQAPPSYGQL----------------IAQGIIP 534

  Fly   544 SL---------LLVAVIVQGIRRLYKPK-----RPRIRKTFVVRKQARTNSAGDTP-LTNRPLAT 593
            .:         ..|::.::||.:|.:..     |.|.|..||.|...|....|..| .|:||..|
Zfish   535 PVEDFPTENPNETVSLSLRGILQLLRQDNASSLRRRRRPRFVRRAVRRLRRWGLIPRATSRPTQT 599

  Fly   594  593
            Zfish   600  599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
lrp10XP_688859.4 CUB 36..136 CDD:238001
LDLa 142..181 CDD:238060
CUB 229..334 CDD:294042 12/33 (36%)
LDLa 427..461 CDD:238060 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.