DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp3

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001019878.1 Gene:Lrp3 / 435965 MGIID:3584516 Length:790 Species:Mus musculus


Alignment Length:308 Identity:61/308 - (19%)
Similarity:104/308 - (33%) Gaps:106/308 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 DHHCASIVRKVKERVDEQSRK-----FEIRSLLDQKIKVLE-----DERCMNDGEYRAATDLCIC 388
            |.||..:       ||.|..:     .|:|...|..::|.|     .:|.:....||:...    
Mouse   300 DLHCTWL-------VDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHR---- 353

  Fly   389 PTGFKGSRCEIRECHN------------------YCV--HGTCQMSE-----LAYPKCYCQPGFK 428
            |...:.::..:...::                  ||:  ...|..||     .....|:.:|   
Mouse   354 PVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSEGDDDSTGEQGCFSEP--- 415

  Fly   429 GERCELSVCSGLCLNGGHCRVSKDENEAPSC---ECPAKFGGARCEQNSTEICSLFCRLLKHEPE 490
             :||:         ...||...:||...|:|   :.|.:.|...|...:..     |...|..|:
Mouse   416 -QRCD---------GWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADR-----CNNQKSCPD 465

  Fly   491 MYVPFGCHS-----------IC---------EELAQDNSTNIAIPQYQHLEVCLTPR-VWTSSVI 534
            ......|.|           :|         :|..||.|.       :|..:...|| |.|:::|
Mouse   466 GADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSD-------EHGCLAAVPRKVITAALI 523

  Fly   535 IILVVGIVSSLLLVAV----IVQGIR----RLYKPKRPRIRKTFVVRK 574
            ..||.|:   ||::|:    .:..:|    |.::.:..|:...||.|:
Mouse   524 GSLVCGL---LLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRRE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Lrp3NP_001019878.1 CUB 64..177 CDD:238001
LDLa 187..221 CDD:238060
LDLa 233..270 CDD:238060
CUB 275..385 CDD:238001 15/95 (16%)
LDLa 436..472 CDD:238060 7/40 (18%)
LDLa 475..509 CDD:238060 6/40 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.