| Sequence 1: | NP_612113.2 | Gene: | cue / 38174 | FlyBaseID: | FBgn0011204 | Length: | 644 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001247284.1 | Gene: | crb / 42896 | FlyBaseID: | FBgn0259685 | Length: | 2253 | Species: | Drosophila melanogaster |
| Alignment Length: | 330 | Identity: | 82/330 - (24%) |
|---|---|---|---|
| Similarity: | 122/330 - (36%) | Gaps: | 117/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 362 DQKIKVLEDERCMNDGEYRAATDL-----CICPTGFKGSRCEIRE---CHNY-CVHG-TCQMSEL 416
Fly 417 AYP----KCYCQPGFKGERCELSVC-------SGLCLNGG---HCRVS---------KDENEAPS 458
Fly 459 -----------------CECPAK-FGGARCEQNSTEICSL---FCRLLK---HEPEMY-----VP 494
Fly 495 FGCHSICEELAQDNSTNI------------AIPQYQHLEVCLTPRVW----------------TS 531
Fly 532 SVIIILVVGIVSSLLLVAVIVQGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQC 596
Fly 597 EITIE 601 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cue | NP_612113.2 | LY | 101..141 | CDD:214531 | |
| Ldl_recept_b | 167..208 | CDD:278487 | |||
| LY | 193..237 | CDD:214531 | |||
| crb | NP_001247284.1 | LamG | 91..228 | CDD:238058 | |
| EGF_CA | 386..423 | CDD:238011 | |||
| EGF_CA | 425..460 | CDD:238011 | |||
| EGF | 466..495 | CDD:278437 | |||
| EGF | 605..633 | CDD:278437 | |||
| EGF_CA | 716..750 | CDD:238011 | |||
| EGF_CA | 753..789 | CDD:238011 | |||
| EGF_CA | 792..828 | CDD:238011 | |||
| EGF_CA | 830..865 | CDD:238011 | |||
| EGF_CA | 868..905 | CDD:238011 | |||
| EGF_CA | 907..943 | CDD:238011 | |||
| EGF_CA | 1009..1045 | CDD:238011 | |||
| EGF_CA | 1047..1082 | CDD:238011 | |||
| Laminin_G_1 | 1155..1290 | CDD:278483 | |||
| EGF | 1316..1346 | CDD:278437 | |||
| Laminin_G_1 | 1388..1550 | CDD:278483 | |||
| EGF_CA | <1593..1622 | CDD:238011 | |||
| Laminin_G_2 | 1692..1828 | CDD:280389 | |||
| EGF_CA | 1901..1937 | CDD:238011 | 82/330 (25%) | ||
| EGF_CA | 1939..1974 | CDD:238011 | 12/37 (32%) | ||
| EGF_CA | 2057..2094 | CDD:238011 | 9/36 (25%) | ||
| EGF_CA | 2096..2133 | CDD:238011 | 6/37 (16%) | ||
| EGF_CA | 2137..2175 | CDD:238011 | 7/41 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24044 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||