DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Dl

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster


Alignment Length:348 Identity:83/348 - (23%)
Similarity:125/348 - (35%) Gaps:76/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 HCAS----------------------IVRKVKERVDEQSRKFEIRSLL-------DQKIKVLEDE 371
            |||:                      |.|.|:..:..:.:.::....:       |.::......
  Fly   361 HCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPN 425

  Fly   372 RCMNDGEYRAATDLCICPTGFKGSRCEI-------RECHNYCVHGTCQMSELAYPKCYCQPGFKG 429
            .|:|.|..: .:..||||.||.|:|||.       .:|.|   .||| :..:...:|.|.|||.|
  Fly   426 PCINGGSCQ-PSGKCICPAGFSGTRCETNIDDCLGHQCEN---GGTC-IDMVNQYRCQCVPGFHG 485

  Fly   430 ERCELSVCSGLCL-----NGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEP 489
            ..|...|  .|||     |||.|   .:.|....|.|.|.|.|..|..:..|..|..|    |..
  Fly   486 THCSSKV--DLCLIRPCANGGTC---LNLNNDYQCTCRAGFTGKDCSVDIDECSSGPC----HNG 541

  Fly   490 EMYV----PFGC-------HSICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVGIVS 543
            ...:    .|.|       ...|:|.:.|:.|..| .||..........:..:.|::|.|..:..
  Fly   542 GTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDA-HQYGATTQARADGLTNAQVVLIAVFSVAM 605

  Fly   544 SLLLV--AVIVQGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQCEITIENCCNM 606
            .|:.|  |.:|..::|  |.||.:.:.....|||...|:..........:.......::......
  Fly   606 PLVAVIAACVVFCMKR--KRKRAQEKDDAEARKQNEQNAVATMHHNGSGVGVALASASLGGKTGS 668

  Fly   607 NICETPCFD---PKLVEQTLSKS 626
            |...|  ||   |.:::.|..||
  Fly   669 NSGLT--FDGGNPNIIKNTWDKS 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722
EGF_CA 291..329 CDD:238011
EGF_CA 337..372 CDD:238011 3/10 (30%)
EGF_CA 453..488 CDD:238011 11/38 (29%)
EGF_CA 492..526 CDD:238011 14/38 (37%)
EGF_CA 529..564 CDD:238011 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.