DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Culd

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster


Alignment Length:144 Identity:31/144 - (21%)
Similarity:46/144 - (31%) Gaps:47/144 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 YPKCYCQPGFKGERCELSVCSGL---CLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICS 479
            |..||....|   .|..:.|..:   |....||....||.::             ||::...: .
  Fly   435 YLNCYIGSEF---LCGNNHCISIRLHCDGFDHCGDGSDEPDS-------------CEEDWAHL-H 482

  Fly   480 LFCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVGI--V 542
            ...|...|:|..|.|                  .|.||..|:.       .:.:.||..:||  |
  Fly   483 HDRRWYSHKPNYYFP------------------KIDQYPDLKT-------ATGIFIISTLGIFGV 522

  Fly   543 SSLLLVAVIVQGIR 556
            .|..:|.:...|:|
  Fly   523 LSGWMVILYRMGVR 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.