DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and ldlra

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001025454.1 Gene:ldlra / 387529 ZFINID:ZDB-GENE-031217-1 Length:911 Species:Danio rerio


Alignment Length:265 Identity:66/265 - (24%)
Similarity:115/265 - (43%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QTIATAAHEF----DELSALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNE 109
            :.|.|.|:.|    .|:..:|.|.||.:.....||                |.||          
Zfish   389 KAIGTIAYLFFTNRHEVRKMTLDRSEYIRVIPRLK----------------NVVA---------- 427

  Fly   110 SVGGLAYDPLNMN-----LFWSDTEQRKIFFAPIHGSATPQVLVDLSAEGGR-----------PD 158
                     |:||     ::|||...:||:  .|.|:.:.     .:|:|.|           |.
Zfish   428 ---------LDMNIASRDIYWSDLSLKKIY--SIRGAISV-----ATADGSRRKTLFKENLAKPR 476

  Fly   159 GVAVDVCRRKLYWTNSNVTHPTVERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGV 223
            .:.||..:..::||:.. |...:|:..|:|.:|:.:::.:|..|.||.:|.|::||:|:|   ..
Zfish   477 AIVVDPIKNFMFWTDWG-TPAKIEKSGLNGVDRSTLVADDIVWPNGITLDLLTERLYWVD---SK 537

  Fly   224 FFSVESSKLDGSDRQVVLKD--KHHEPLNLAVTNDAIYWTDRTTRAVWSHPKV---PVIKVTT-T 282
            ..::.|..:.|..|:.::.|  |...||:|.|..:.::|||.:..|:.|..:|   .:.||.. .
Zfish   538 LHTLSSISVQGDGRRTLIIDQGKLAHPLSLTVFEEKVFWTDVSNNAILSANRVTGGDITKVAEHL 602

  Fly   283 SKPDE 287
            |.|::
Zfish   603 SSPED 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531 9/44 (20%)
Ldl_recept_b 167..208 CDD:278487 11/40 (28%)
LY 193..237 CDD:214531 12/43 (28%)
ldlraNP_001025454.1 LDLa 23..55 CDD:197566
Ldl_recept_a 63..101 CDD:365841
LDLa 106..140 CDD:238060
LDLa 144..176 CDD:197566
Ldl_recept_a 192..227 CDD:365841
Ldl_recept_a 231..266 CDD:365841
LDLa 274..304 CDD:238060
FXa_inhibition 314..348 CDD:373209
EGF_CA 350..380 CDD:214542
Ldl_recept_b 437..481 CDD:278487 11/50 (22%)
Ldl_recept_b 485..525 CDD:278487 11/40 (28%)
LY 510..551 CDD:214531 12/43 (28%)
Ldl_recept_b 572..611 CDD:278487 10/36 (28%)
FXa_inhibition 623..664 CDD:373209
PHA03247 <666..808 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.