DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and CG6553

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:313 Identity:51/313 - (16%)
Similarity:90/313 - (28%) Gaps:123/313 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 ATDLCICPTGFKGSRCEIRECHNYCVHGTC-QMSELA----------------YPKCYCQPGFKG 429
            |..:|:      ||: ....|.:.|..|.| |:.:|.                ..|.:| ||: .
  Fly    19 AVTICL------GSQ-NATSCGHRCGGGDCIQLDQLCDGSANCLDGSDETVAMCEKVWC-PGY-A 74

  Fly   430 ERC-------ELSVCSGL--CLNGGH-----CRVSKDENEAPSCECPAKFG----------GAR- 469
            .||       ..:||.|:  |::|..     ||....:....:.|.....|          |.| 
  Fly    75 FRCSYGACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCDNWEMYCSSGQCMTYSKLCDGIRD 139

  Fly   470 CEQNSTEICSLFCRLLK------------------HEPEMYVPFGCHSICEELAQDNSTNIAIPQ 516
            |.....|:.|| |..:.                  |.....||....:......|:|. ...:||
  Fly   140 CRDGDDELESL-CEGVTIPTTTVSSTTSTTTESSIHRITPTVPVTRKASRPNPLQENG-ECVVPQ 202

  Fly   517 YQHLEV-------------------------------------------------CLTPRVWTSS 532
            ..::.|                                                 |.||:.:..|
  Fly   203 LPNVMVKHFTDAILTVGSRVANGTRIYYDCPAEHRLKGENQNICQDALWARKFPYCETPQAYVFS 267

  Fly   533 VIIILVVGIVSSLLLVAVIVQGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTP 585
            ::|::...::   :::..::..:||....:|.|....::|...:........|
  Fly   268 LVIVIFCFLI---VVLVFLIWRVRRENGSRRQREEHIWLVETSSNLPQTSSIP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
CG6553NP_610911.1 LDLa 34..60 CDD:197566 5/25 (20%)
LDLa 70..101 CDD:197566 10/32 (31%)
LDLa 115..146 CDD:197566 5/30 (17%)
Frag1 <260..>303 CDD:287278 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.