DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Cd320

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001014223.1 Gene:Cd320 / 362851 RGDID:1305860 Length:264 Species:Rattus norvegicus


Alignment Length:206 Identity:42/206 - (20%)
Similarity:68/206 - (33%) Gaps:67/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CPTG-FK----------GSRCE-IRECHNYCVHGTCQMSELAYPK-CYCQPGFKGERCELSVCSG 439
            |||. ||          ..||: .|:|.:......|::...|..: |..||...        || 
  Rat    51 CPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRIEPCAQNRQCQPQPALP--------CS- 106

  Fly   440 LCLNGGHCRVSKDENEAPSC-ECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEE 503
             |.|...|....|:|  .:| ..|.:.|..||..:  ::|..........|:      |....:|
  Rat   107 -CDNISGCSAGSDKN--LNCSRSPCQEGELRCILD--DVCIPHTWRCDGHPD------CPDSSDE 160

  Fly   504 LAQDNST---------------------------NIAIPQYQHLEVCLTPRVWTSSVIIILVVGI 541
            |:.|..|                           |:.:....|      |....::..:|...|:
  Rat   161 LSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGH------PSRNPNAYGVIAAAGV 219

  Fly   542 VSSLLLVAVIV 552
            :|::|:.|.|:
  Rat   220 LSAILVSATIL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Cd320NP_001014223.1 LDLa 51..86 CDD:238060 9/34 (26%)
LDLa 128..163 CDD:238060 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.