Sequence 1: | NP_612113.2 | Gene: | cue / 38174 | FlyBaseID: | FBgn0011204 | Length: | 644 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014223.1 | Gene: | Cd320 / 362851 | RGDID: | 1305860 | Length: | 264 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 42/206 - (20%) |
---|---|---|---|
Similarity: | 68/206 - (33%) | Gaps: | 67/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 CPTG-FK----------GSRCE-IRECHNYCVHGTCQMSELAYPK-CYCQPGFKGERCELSVCSG 439
Fly 440 LCLNGGHCRVSKDENEAPSC-ECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEE 503
Fly 504 LAQDNST---------------------------NIAIPQYQHLEVCLTPRVWTSSVIIILVVGI 541
Fly 542 VSSLLLVAVIV 552 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cue | NP_612113.2 | LY | 101..141 | CDD:214531 | |
Ldl_recept_b | 167..208 | CDD:278487 | |||
LY | 193..237 | CDD:214531 | |||
Cd320 | NP_001014223.1 | LDLa | 51..86 | CDD:238060 | 9/34 (26%) |
LDLa | 128..163 | CDD:238060 | 8/42 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |