DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp8

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_006238632.1 Gene:Lrp8 / 362558 RGDID:1305729 Length:1013 Species:Rattus norvegicus


Alignment Length:599 Identity:120/599 - (20%)
Similarity:201/599 - (33%) Gaps:211/599 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNE--SVGGLAYDPLNMNLFW 125
            ||..:.....||:.||.:|  .|:|...|..:   :.::.:...|.:  |..|||.|.::.:::|
  Rat   504 ALDVEVDTNRIYWCDLSYR--KIYSAHMDKAS---IPDEQVVLIGEQLHSPEGLAVDWVHKHIYW 563

  Fly   126 SDTEQRKIFFAPIHGSATPQVL-VDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPTVERINLDGS 189
            :|:..:.:..|...|.....:. .|||    .|..:|||..|..:||::... ...:|:..|:|:
  Rat   564 TDSGNKTVSVATTDGRRRCTLFNRDLS----EPRAIAVDPLRGFMYWSDWGF-QAKIEKAGLNGA 623

  Fly   190 NRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVL--KDKHHEPLNLA 252
            :|..::|.||:.|.||.:|.||.||:|:|   .....:.|...:|.:|::::  .|....|..:|
  Rat   624 DRQTLVSDNIEWPNGITLDLLSQRLYWVD---SKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVA 685

  Fly   253 VTNDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPEPVAEDCPLVRVANLSEE 317
            |..|.::|||....|::|..::..::::                                     
  Rat   686 VFEDKVFWTDLENEAIFSANRLNGLEIS------------------------------------- 713

  Fly   318 ARGIVARTGFYQRLQKDHHCASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAA 382
               |:|     :.|...|                                               
  Rat   714 ---ILA-----ENLNNPH----------------------------------------------- 723

  Fly   383 TDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCELSV-----CSGLCL 442
             |:.|                         ..||..||.       .:.||||.     |..|||
  Rat   724 -DIVI-------------------------FHELKQPKA-------ADACELSAQPNGGCEYLCL 755

  Fly   443 NGGHCRVSKDENEAP--SCECPAKF----GGARC-----EQNSTEICSLFCRLL----------- 485
                 ...:..:.:|  :|.||...    ...||     ..::|.:.|...|.:           
  Rat   756 -----PAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPPSTSTTTLASAMTRTVPATTGAPGTTI 815

  Fly   486 ------KHEPEM-----YVPFGCHSICEELAQDNSTNIAIP-QYQHLEVCLTPRVWTSSVIIILV 538
                  .|..||     .||   ||:....|...|.:...| ...|.:..........|.:...|
  Rat   816 HDSTYQNHSTEMPSQTAAVP---HSVNIPKAHSTSPSTLSPATSNHSQHYGNEGSQMGSTVTAAV 877

  Fly   539 VGIVSSLLLVAVIVQG---IRRLYKPK--------RPRIRKTFVVRKQ-----ARTNSAGDT-PL 586
            :||:..::::|::...   |.|.:|.|        .|..|||....::     .||...|.. |.
  Rat   878 IGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEEEDELHIGRTAQIGHVYPA 942

  Fly   587 T----NRPLATEQC 596
            .    :|||..|.|
  Rat   943 AISSYDRPLWAEPC 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531 9/41 (22%)
Ldl_recept_b 167..208 CDD:278487 12/40 (30%)
LY 193..237 CDD:214531 15/43 (35%)
Lrp8XP_006238632.1 LDLa 44..78 CDD:238060
LDLa 82..114 CDD:197566
LDLa 124..160 CDD:238060
LDLa 203..235 CDD:197566
LDLa 256..289 CDD:238060
LDLa 295..329 CDD:238060
LDLa 333..369 CDD:294076
FXa_inhibition 390..424 CDD:291342
EGF_CA 426..456 CDD:214542
LY 495..530 CDD:214531 9/27 (33%)
LY 540..581 CDD:214531 10/40 (25%)
Ldl_recept_b 602..642 CDD:278487 12/40 (30%)
LY 626..668 CDD:214531 15/44 (34%)
Ldl_recept_b 689..728 CDD:278487 12/156 (8%)
FXa_inhibition 747..784 CDD:291342 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.