DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Ndg

DIOPT Version :10

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_610575.1 Gene:Ndg / 36089 FlyBaseID:FBgn0026403 Length:1350 Species:Drosophila melanogaster


Alignment Length:202 Identity:61/202 - (30%)
Similarity:89/202 - (44%) Gaps:54/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GLAYDPLNMNLFWSDTEQRKIFFAPIHGS-ATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNV 176
            ||..|.:...::|.|...:||......|: ..|.:..|:.:    |:|:|:||..|:|||.:|  
  Fly  1076 GLDKDCVEGRVYWGDISTKKIVSTKYDGTDLRPFITTDIES----PEGIAIDVISRRLYWADS-- 1134

  Fly   177 THPTVERINLDG-SNRTVIISSNIDMPRGIVVDQLSDRLFWID-DLKGVFFSVESSKLDGSDRQV 239
            ...|:|..:||. |.|.|||:..:..||||.||...::|||.| |.:..  .:|.|.|||:.|::
  Fly  1135 AKDTIEVASLDDPSLRAVIINKQLVNPRGIAVDPYREKLFWSDWDRESP--KIEMSNLDGTGREL 1197

  Fly   240 VL-KD------------------------KHHE------------------PLNLAVTNDAIYWT 261
            :| ||                        |..|                  |..:..|:|..|||
  Fly  1198 LLGKDDVTLPNSLVVLENSGEVCYADAGTKKVECIEPQNRQIRTISNELSYPFGITFTHDQFYWT 1262

  Fly   262 DRTTRAV 268
            |.||:.|
  Fly  1263 DWTTKKV 1269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 TerD_like 48..>85 CDD:473128
YvrE <73..>164 CDD:442613 13/51 (25%)
LY 101..141 CDD:214531 7/27 (26%)
Ldl_recept_b 167..208 CDD:459654 18/41 (44%)
LY 193..237 CDD:214531 19/44 (43%)
NdgNP_610575.1 NIDO 108..262 CDD:214712
EGF_3 285..320 CDD:463759
G2F 322..549 CDD:214774
EGF_CA 591..622 CDD:429571
EGF_3 797..828 CDD:463759
EGF_3 836..873 CDD:463759
EGF_3 963..995 CDD:463759
EGF_3 1001..1036 CDD:463759
NHL 1074..>1254 CDD:302697 52/185 (28%)
NHL repeat 1074..1112 CDD:271320 9/35 (26%)
LY 1107..1145 CDD:214531 14/43 (33%)
NHL repeat 1117..1156 CDD:271320 19/40 (48%)
LY 1152..1195 CDD:214531 19/44 (43%)
NHL repeat 1161..1202 CDD:271320 18/42 (43%)
NHL repeat 1210..1244 CDD:271320 2/33 (6%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.