DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and LRP1

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001260800.2 Gene:LRP1 / 35799 FlyBaseID:FBgn0053087 Length:4752 Species:Drosophila melanogaster


Alignment Length:856 Identity:173/856 - (20%)
Similarity:287/856 - (33%) Gaps:278/856 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLLLATCLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHEFDELSALTFD----ESEELI 73
            :||||:           |.:|...|..|.:      .|......:.|.|....||    ..:.|:
  Fly  3942 ILLLAS-----------EQEFRFILPAKQE------GTTVVGFFQTDSLKIDVFDILIRPKDTLL 3989

  Fly    74 YFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGN-------------ESVGGLAYDPLNMNLFW 125
            ::.|..|  |.:.::|   ||..|| |.|..|...             :....||.|.::..::.
  Fly  3990 FWIDSHH--GKVHTMK---IATPHV-EGTGVRVRRDLKELTAFNIPELDDPKSLAVDWISQRVYI 4048

  Fly   126 SDTEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPTVER----INL 186
            .|:...:|....|.|    :..:.|.:.|..|..:.::...|.:.|:       |:|.    .:|
  Fly  4049 IDSRHNQILATDIEG----KKYISLVSTGMNPTDIVLEPESRIMIWS-------TLENGILVASL 4102

  Fly   187 DGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVLKDKHHE-PLN 250
            ||||:..::..::..|..:.:|..:.||:|.|..||   ::|:.:|:|.||.||.:..:.| |..
  Fly  4103 DGSNKKSLVERDVGWPISLSMDYPTGRLYWADYRKG---TIETCRLNGKDRNVVRRFGNREKPQK 4164

  Fly   251 LAVTNDAIY--------------WTDRTTRAVWSHPKV------PVIKVTTTSKPDEED------ 289
            :.|..|.:|              ..|..|..:..:...      |:.:....|.|..:|      
  Fly  4165 IDVFEDYLYIKLYDQSIIKMNKFGNDNGTYLLKGYRSSDIGILHPMKQNRNISNPCAKDPCKSSR 4229

  Fly   290 ----------------------STDSTDFKDPEPVAEDCPL---VRVANLSEEARGIVARTGFYQ 329
                                  .||....|....:.:.|||   :....:.:.....:.:..|..
  Fly  4230 ALCILSSESSVGYSCKCAEGYVMTDDGVCKAHADIPDYCPLQCNLGTCKIVDHVPKCICQPQFEG 4294

  Fly   330 RLQKDHHCASIVRKV---------------------------KERVDE-----QSRKFEIRSLLD 362
            .|.:.:.|:...:..                           ..|.:.     |||.....|.|.
  Fly  4295 ELCEHYRCSGYCQNYGVCSVAPALPGSQEPPPLKCTCTAGWSGARCETSMPACQSRCHNGGSCLI 4359

  Fly   363 QKI--------KVLEDER--------CMNDG---EYRAATDLCICPTGFKGSRCEIRECHNYCVH 408
            .:.        |:...|:        |.|.|   |....|..|.||.||.|.||||.||.::|.:
  Fly  4360 SETEGMKCSCPKMFTGEQCEHCRNLTCENGGICRETLTGTPQCECPDGFTGKRCEIDECADFCKN 4424

  Fly   409 -GTCQMSELAYPKCYCQPGFKGERCELSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQ 472
             |:|.:|.....:|.|..|:.||.||.:.|...|.|||.|   .:.....||.||.::.|..||.
  Fly  4425 GGSCVISTKGQRQCKCPSGYFGEHCESNSCRDFCRNGGTC---SERGGRLSCTCPPRYIGESCES 4486

  Fly   473 ------------NSTEI-----CSLF-------CRLLK--------------------------- 486
                        ::|::     |:|.       |.::|                           
  Fly  4487 DLCKTSSPPHFCDNTKVPTRDPCTLMICQNAGTCHIIKGVALCNCTDQWNGDLCTLPVTDDNPCA 4551

  Fly   487 ---------HEPEMYVPFGCHSI------------------CEELAQDNSTNIAIPQYQHLEVCL 524
                     |..|..:|. |..|                  |......:|.|..:.:...:..||
  Fly  4552 RYCANGGVCHLDEYRLPH-CSCIGEWQGNACEMPPHCVGGECNVCRPGSSINECLCENNRVVPCL 4615

  Fly   525 TPRV---------WTSSVIIILVVGIVSSLLLVAVIVQGIRRLYKPKRPRIRKTFVVRKQARTNS 580
            :...         ..|..:..:||.:::.:|||..:..|  .:|..|:.||.:.|   ..||...
  Fly  4616 SDSADALKEEQEPTESGGVFSVVVLVLAVILLVFALFAG--AVYFLKKHRIAQPF---SHARLTD 4675

  Fly   581 AGDTPLTN---RPLATEQCEITIE----NCCNMNICETPCFD-------PKLVEQTLSKSSCKED 631
            ..:..|||   |..|.|......|    |..|      |.::       |:.|...::.|:..::
  Fly  4676 NVEIMLTNAMYRGDADEAPTFASEDDKGNFAN------PVYESMYADAIPEPVSTEITHSTAPDE 4734

  Fly   632 KKILIHNMEDD 642
            :|.|:.:..|:
  Fly  4735 RKGLLQHTHDE 4745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531 8/52 (15%)
Ldl_recept_b 167..208 CDD:278487 10/44 (23%)
LY 193..237 CDD:214531 11/43 (26%)
LRP1NP_001260800.2 LDLa 87..118 CDD:197566
LDLa 126..163 CDD:238060
EGF_CA 246..283 CDD:214542
Ldl_recept_b 449..487 CDD:278487
LY 472..513 CDD:214531
LY 817..852 CDD:214531
LDLa 1057..1092 CDD:197566
LDLa 1104..1134 CDD:238060
FXa_inhibition 1289..1317 CDD:291342
LY 1434..1476 CDD:214531
LY 1477..1521 CDD:214531
LY 1533..1567 CDD:214531
LY 1568..1611 CDD:214531
FXa_inhibition 1639..1676 CDD:291342
LY 1794..1838 CDD:214531
LY 2078..2112 CDD:214531
NHL <2082..>2152 CDD:302697
NHL repeat 2082..2120 CDD:271320
FXa_inhibition 2269..2303 CDD:291342
LY 2430..2471 CDD:214531
LY 2475..2517 CDD:214531
LDLa 2630..2661 CDD:238060
LDLa 2671..2702 CDD:238060
LDLa 2727..2759 CDD:238060
LDLa 2773..2802 CDD:238060
LDLa 2810..2844 CDD:238060
LDLa 2848..2878 CDD:238060
LDLa 2887..2916 CDD:197566
LDLa 2938..2969 CDD:197566
LDLa 2989..3015 CDD:197566
LDLa 3030..3061 CDD:238060
EGF_CA 3062..>3091 CDD:214542
EGF_CA 3103..3141 CDD:214542
LY 3212..3254 CDD:214531
LY 3255..3297 CDD:214531
LY 3299..3340 CDD:214531
LY 3354..3389 CDD:214531
LDLa 3458..3490 CDD:238060
LDLa 3499..3533 CDD:238060
LDLa 3582..3616 CDD:238060
LDLa 3621..3652 CDD:197566
LDLa 3663..3697 CDD:238060
LDLa 3702..3736 CDD:238060
LDLa 3776..3808 CDD:197566
LDLa 3818..3849 CDD:197566
LDLa 3860..3894 CDD:238060
NHL 4029..>4158 CDD:302697 34/142 (24%)
NHL repeat 4034..4074 CDD:271320 8/43 (19%)
NHL repeat 4076..4115 CDD:271320 10/45 (22%)
LY 4108..4150 CDD:214531 11/44 (25%)
NHL repeat 4121..4158 CDD:271320 14/39 (36%)
EGF_CA <4386..4414 CDD:238011 12/27 (44%)
EGF_CA 4415..4450 CDD:238011 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.