DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp4

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_727914.1 Gene:Lrp4 / 32552 FlyBaseID:FBgn0030706 Length:2009 Species:Drosophila melanogaster


Alignment Length:244 Identity:64/244 - (26%)
Similarity:116/244 - (47%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WDFAVTLRTKIQFMDSSWQTIATAAHEFDELSALTFDESEELIYFNDLKHRNGSIFSLKRDLIAA 95
            ||.     .::...::.:..|....|   ...||.|...:.|::::|:     |...:|  ::..
  Fly   619 WDI-----RRVTLSNNRYSAIVKGLH---NAIALDFHHRKGLMFWSDV-----STDVIK--MVYM 668

  Fly    96 NHVAEQTIARTGNESVGGLAYDPLNMNLFWSDTEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGV 160
            |....:.:.:.|.||.||:|.|.::..|||:|:..|::..:...|:..   .|..|.:..:|..:
  Fly   669 NGTRVRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGNLR---TVIASYDLDKPRAI 730

  Fly   161 AVDVCRRKLYWTNSNVTHPTVERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFF 225
            .|.......:|::.. .:|.:||..:||:.|.||||..:..|.|:.:|..:.:::|.|..:   .
  Fly   731 VVHPGEALAFWSDWG-PNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYWADAKQ---H 791

  Fly   226 SVESSKLDGSDRQVVLKDKHHEPLNLAVTNDAIYWTDRTTRAVWSHPKV 274
            ::|.|.||||||..:|......|..|.:..|.:||||..|:.|.:..|:
  Fly   792 AIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKI 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531 12/39 (31%)
Ldl_recept_b 167..208 CDD:278487 13/40 (33%)
LY 193..237 CDD:214531 15/43 (35%)
Lrp4NP_727914.1 LDLa 267..301 CDD:238060
LDLa 306..340 CDD:238060
LDLa 347..390 CDD:238060
LDLa 397..431 CDD:238060
LDLa 442..476 CDD:238060
LDLa 480..521 CDD:238060
FXa_inhibition 576..604 CDD:291342
LY 634..671 CDD:214531 10/46 (22%)
NHL <656..793 CDD:302697 37/150 (25%)
LY 680..714 CDD:214531 12/33 (36%)
NHL repeat 681..722 CDD:271320 13/43 (30%)
NHL repeat 726..760 CDD:271320 8/34 (24%)
LY 761..803 CDD:214531 15/44 (34%)
NHL repeat 769..793 CDD:271320 5/26 (19%)
FXa_inhibition 882..912 CDD:291342
LY 946..985 CDD:214531
NHL <967..1142 CDD:302697
LY 988..1030 CDD:214531
NHL repeat 998..1037 CDD:271320
NHL repeat 1038..1080 CDD:271320
NHL repeat 1084..1119 CDD:271320
FXa_inhibition 1185..1220 CDD:291342
NHL 1260..>1445 CDD:302697
NHL repeat 1260..1296 CDD:271320
NHL repeat 1302..1337 CDD:271320
NHL repeat 1345..1383 CDD:271320
FXa_inhibition <1499..1525 CDD:291342
LY 1600..1640 CDD:214531
LY 1643..1686 CDD:214531
LY 1688..1729 CDD:214531
FXa_inhibition 1801..>1825 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.