DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and C901

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster


Alignment Length:150 Identity:44/150 - (29%)
Similarity:62/150 - (41%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 CMNDGEYRAATDLCICPTGFKGSRCEIRECHNY--CVHGTCQMSELAYPKCYCQPGFKGERCE-- 433
            |...||       |.|..|:.||:|:  :|..|  |.:|.|:    |..:|.|.||:.|..|:  
  Fly   223 CRKPGE-------CRCKVGWTGSQCD--KCFPYPGCANGDCE----APWECNCHPGWGGMLCDEK 274

  Fly   434 LSVC---SGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPF 495
            |:.|   ...|.|||.|.....|:.:..|:|...|.|..|     ||...|....:..|.:..|.
  Fly   275 LTYCVEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNC-----EIRDDFLLTSEAPPRITPPT 334

  Fly   496 GCHSICE---ELAQDNSTNI 512
            ....:.|   ||.|:...:|
  Fly   335 PAELVLELDGELDQNGQQDI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
C901NP_572673.1 DSL <56..79 CDD:302925
EGF_CA 280..315 CDD:238011 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.