DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp12

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001128355.1 Gene:Lrp12 / 314941 RGDID:1304943 Length:858 Species:Rattus norvegicus


Alignment Length:249 Identity:50/249 - (20%)
Similarity:87/249 - (34%) Gaps:77/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 EDERCMNDGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCE 433
            |.:||  ||.:.       ||.|.....|.:.:...:    .|..:.:.||        :.:||.
  Rat   391 EQQRC--DGYWH-------CPNGRDEINCTMCQKEEF----PCSRNGVCYP--------RSDRCN 434

  Fly   434 LSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPFGCH 498
            ..         .||....||.....|: |..|   .|:.|.....|..|             ...
  Rat   435 YQ---------NHCPNGSDEKNCFFCQ-PGNF---HCKNNRCVFESWVC-------------DSQ 473

  Fly   499 SICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVGIVSSLLLVAV--------IVQGI 555
            ..|.:.:.:.|..:.:|          .||.|::||..||.|:   ||::|:        :....
  Rat   474 DDCGDGSDEESCPVIVP----------TRVITAAVIGSLVCGL---LLVIALGCTCKLYSLRMFE 525

  Fly   556 RRLYKPKRPRIRKTFVVRKQARTNSAGD-------TPLTNRPLATEQCEITIEN 602
            ||.::.:..|: :..::|::| ..|.|.       .|:.:.|:.:......:||
  Rat   526 RRSFETQLSRV-EAELLRREA-PPSYGQLIAQGLIPPVEDFPVCSPNQASVLEN 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Lrp12NP_001128355.1 CUB 47..158 CDD:238001
LDLa 166..200 CDD:238060
LDLa 215..254 CDD:238060
CUB 267..371 CDD:238001
LDLa 375..410 CDD:238060 8/27 (30%)
LDLa 413..448 CDD:238060 9/55 (16%)
LDLa 451..485 CDD:238060 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.