DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp12

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_006520965.1 Gene:Lrp12 / 239393 MGIID:2443132 Length:859 Species:Mus musculus


Alignment Length:249 Identity:48/249 - (19%)
Similarity:87/249 - (34%) Gaps:77/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 EDERCMNDGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCE 433
            |.:||  ||.:.       ||.|.....|.:.:...:    .|..:.:.||        :.:||.
Mouse   392 EQQRC--DGYWH-------CPNGRDEINCTMCQKEEF----PCSRNGVCYP--------RSDRCN 435

  Fly   434 LSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPFGCH 498
            ..         .||....||.....|: |..|   .|:.|.....|..|             ...
Mouse   436 YQ---------NHCPNGSDEKNCFFCQ-PGNF---HCKNNRCVFESWVC-------------DSQ 474

  Fly   499 SICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVGIVSSLLLVAV--------IVQGI 555
            ..|.:.:.:.:..:.:|          .||.|::||..|:.|:   ||::|:        :....
Mouse   475 DDCGDGSDEENCPVIVP----------TRVITAAVIGSLICGL---LLVIALGCTCKLYSLRMFE 526

  Fly   556 RRLYKPKRPRIRKTFVVRKQARTNSAGD-------TPLTNRPLATEQCEITIEN 602
            ||.::.:..|: :..::|::| ..|.|.       .|:.:.|:.:......:||
Mouse   527 RRSFETQLSRV-EAELLRREA-PPSYGQLIAQGLIPPVEDFPVCSPNQASVLEN 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Lrp12XP_006520965.1 CUB 47..156 CDD:366096
LDLa 167..201 CDD:238060
LDLa 216..255 CDD:238060
CUB 268..372 CDD:238001
LDLa 376..411 CDD:238060 8/27 (30%)
LDLa 414..449 CDD:238060 9/55 (16%)
LDLa 452..486 CDD:238060 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.