DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Vldlr

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_038731.2 Gene:Vldlr / 22359 MGIID:98935 Length:873 Species:Mus musculus


Alignment Length:506 Identity:98/506 - (19%)
Similarity:168/506 - (33%) Gaps:181/506 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLNMNLFWSD 127
            ||..|.:.:.:::.||..:  :|||...|.....|.  :.|....|.:  .:|.|.:...::|:|
Mouse   473 ALDADIAAQKLFWADLSQK--AIFSASIDDKVGRHF--KMIDNVYNPA--AIAVDWVYKTIYWTD 531

  Fly   128 TEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPT-VERINLDGSNR 191
            ...:.|..|.:.|:....:   .:::...|..:|||.....:||  |:...|. :|:..::|.:|
Mouse   532 AASKTISVATLDGAKRKFL---FNSDLREPASIAVDPLSGFVYW--SDWGEPAKIEKAGMNGFDR 591

  Fly   192 TVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVLKDKHH--EPLNLAVT 254
            ..:::.:|..|.||.:|.:..||:|:|....:..||:   |:|.||::|||....  .||.|.:.
Mouse   592 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVD---LNGQDRRIVLKSLEFLAHPLALTIF 653

  Fly   255 NDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPEPVAEDCPLVRVANLSEEAR 319
            .|.:||.|....||:...|                      |...|       |..:.|...:|:
Mouse   654 EDRVYWIDGENEAVYGANK----------------------FTGSE-------LATLVNNLNDAQ 689

  Fly   320 GIVARTGFYQRLQKDHHCASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAATD 384
            .|:.    |..|                                                     
Mouse   690 DIIV----YHEL----------------------------------------------------- 697

  Fly   385 LCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCELSVCSGLCLNGGHCRV 449
              :.|:|                            |.:|:...:...||.     |||.....  
Mouse   698 --VQPSG----------------------------KNWCEDDMENGGCEY-----LCLPAPQI-- 725

  Fly   450 SKDENEAPSCECPAKF----GGARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQDNST 510
             .|.:...:|.||..:    .|..|:..||             |..|         .|....|:|
Mouse   726 -NDHSPKYTCSCPNGYNLEENGRECQSTST-------------PVTY---------SETKDINTT 767

  Fly   511 NI-----AIPQYQHL-----EVCLTPR----VWTSSVIIILVVGIVSSLLL 547
            :|     .:|...::     ||.:.|:    .|....:::||:..|...|:
Mouse   768 DILRTSGLVPGGINVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLM 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531 8/39 (21%)
Ldl_recept_b 167..208 CDD:278487 11/41 (27%)
LY 193..237 CDD:214531 13/43 (30%)
VldlrNP_038731.2 LDLa 33..67 CDD:238060
LDLa 71..103 CDD:197566
Ldl_recept_a 111..149 CDD:365841
Ldl_recept_a 153..188 CDD:365841
Ldl_recept_a 192..224 CDD:365841
Ldl_recept_a 237..273 CDD:365841
Ldl_recept_a 276..312 CDD:365841
Ldl_recept_a 320..350 CDD:365841
FXa_inhibition 360..394 CDD:373209
EGF_CA 396..426 CDD:214542
LDL-receptor class B 1 439..480 3/6 (50%)
LY 461..499 CDD:214531 8/27 (30%)
LDL-receptor class B 2 481..524 11/48 (23%)
Ldl_recept_b 481..521 CDD:278487 10/45 (22%)
LY 508..547 CDD:214531 9/40 (23%)
LDL-receptor class B 3 525..567 9/44 (20%)
LDL-receptor class B 4 568..611 12/44 (27%)
Ldl_recept_b 568..608 CDD:278487 11/41 (27%)
LY 592..634 CDD:214531 13/44 (30%)
LDL-receptor class B 5 612..654 16/44 (36%)
LDL-receptor class B 6 655..697 14/74 (19%)
Ldl_recept_b 655..694 CDD:278487 13/71 (18%)
FXa_inhibition 711..749 CDD:373209 10/45 (22%)
Clustered O-linked oligosaccharides 751..790 10/60 (17%)
Endocytosis signal. /evidence=ECO:0000255 832..837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.