DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and egg-2

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_498537.1 Gene:egg-2 / 187510 WormBaseID:WBGene00019811 Length:548 Species:Caenorhabditis elegans


Alignment Length:227 Identity:47/227 - (20%)
Similarity:78/227 - (34%) Gaps:71/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 CASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMN-----DGEYRAA-------------- 382
            |.||. ..:..::|:|.|.:..|:|...|.:..::.|..     ||...|:              
 Worm   162 CQSIY-SCRAHIEEESEKKDKTSVLPTLICLTAEKLCNGVENCPDGSDEASCRSKCSKDQFKCSG 225

  Fly   383 TDLCICPTGFKGSRCE-IRECHNYCVHGTCQMSELAYPKCYCQPGFKGERC--ELSVCSGLCLNG 444
            :|.|: |...|   |: :.:|.|......|...:....||       |:.|  ...||.|:    
 Worm   226 SDACL-PISVK---CDGVSDCENESDESNCNKCQKGAHKC-------GKNCIKASKVCDGI---- 275

  Fly   445 GHCRVSKDENEAPSCECPAKFGG--ARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQD 507
            ..|....||::   |:|....|.  |.||..:..:.|..|.            |.|...:.:.::
 Worm   276 PDCDDGSDEHQ---CDCKTCSGSEKALCEDGTCIMRSQVCD------------GKHDCLDGIDEE 325

  Fly   508 N----------STNIAI------PQYQHLEVC 523
            |          |:.:.:      .||..:|.|
 Worm   326 NCPGSCSNERFSSKLKLLTCDDGNQYSEVEAC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
egg-2NP_498537.1 LDLa 123..159 CDD:238060
LDLa 216..251 CDD:238060 7/38 (18%)
LDLa 254..287 CDD:238060 10/46 (22%)
LDLa 300..327 CDD:238060 6/38 (16%)
LDLa 424..453 CDD:238060
LDLa 456..491 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.