Sequence 1: | NP_612113.2 | Gene: | cue / 38174 | FlyBaseID: | FBgn0011204 | Length: | 644 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498537.1 | Gene: | egg-2 / 187510 | WormBaseID: | WBGene00019811 | Length: | 548 | Species: | Caenorhabditis elegans |
Alignment Length: | 227 | Identity: | 47/227 - (20%) |
---|---|---|---|
Similarity: | 78/227 - (34%) | Gaps: | 71/227 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 337 CASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMN-----DGEYRAA-------------- 382
Fly 383 TDLCICPTGFKGSRCE-IRECHNYCVHGTCQMSELAYPKCYCQPGFKGERC--ELSVCSGLCLNG 444
Fly 445 GHCRVSKDENEAPSCECPAKFGG--ARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQD 507
Fly 508 N----------STNIAI------PQYQHLEVC 523 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cue | NP_612113.2 | LY | 101..141 | CDD:214531 | |
Ldl_recept_b | 167..208 | CDD:278487 | |||
LY | 193..237 | CDD:214531 | |||
egg-2 | NP_498537.1 | LDLa | 123..159 | CDD:238060 | |
LDLa | 216..251 | CDD:238060 | 7/38 (18%) | ||
LDLa | 254..287 | CDD:238060 | 10/46 (22%) | ||
LDLa | 300..327 | CDD:238060 | 6/38 (16%) | ||
LDLa | 424..453 | CDD:238060 | |||
LDLa | 456..491 | CDD:238060 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160167877 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |