DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and R08E3.1

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001338800.1 Gene:R08E3.1 / 180758 WormBaseID:WBGene00019957 Length:1943 Species:Caenorhabditis elegans


Alignment Length:255 Identity:59/255 - (23%)
Similarity:88/255 - (34%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 CMNDGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGFKGERCELSVC 437
            |.:||..:..:  |:|...:..:.|..|:|.|:...|. ..|.....:|.|.|||.|..||    
 Worm    37 CSHDGFLKDGS--CVCTADYNSNSCLKRKCRNFGFDGQ-SFSSNKVDRCICPPGFLGRNCE---- 94

  Fly   438 SGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNST-EICSLFCRLLKHEPEMY--------- 492
            ...|:.|.:...|...:| .|....|.|.....|...| .|.:|||     |.|.|         
 Worm    95 PVKCVPGSNQAYSSSNSE-KSISLLASFNTKMAETWQTGNIGNLFC-----EKEGYWRSFNYNYD 153

  Fly   493 ------VPFGCHSICEELAQD------------NSTNIAIPQYQHLEVCLTPRVWTSSVIIILVV 539
                  .|....:.|.|..||            |:|........:|...:......|.|.::..:
 Worm   154 NAGYTSSPSENTTTCTEKVQDYLTPDPCQNDYGNATTCGQLDINNLNSLVQNSPPNSIVFVVTNM 218

  Fly   540 GIVSSLLLVA----VIVQGIRRLYKPKRPRIRKTFVVRKQA--RTNSAGDTPLTNRPLAT 593
            |::.|....|    :|...|.|       ||:...:|....  .::.:|...|:|...||
 Worm   219 GVIPSSATDAMAEDIIATSIAR-------RIQINVIVYNNTDFLSSDSGLAYLSNITSAT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
R08E3.1NP_001338800.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.