DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and Lrp6

DIOPT Version :10

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_032540.2 Gene:Lrp6 / 16974 MGIID:1298218 Length:1613 Species:Mus musculus


Alignment Length:405 Identity:99/405 - (24%)
Similarity:166/405 - (40%) Gaps:112/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHE---------FDELSALTFDESEELIY 74
            ||::|.  .|.   :.....|.::.:::. :|....|.|         ...:|..|.|.::.::.
Mouse   297 CLMSPV--KPF---YQCACPTGVKLLENG-KTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQ 355

  Fly    75 FNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLNMNLFWSDTEQRKIFFAPIH 139
            ..|::|                     .||         :.|||:...::|:|.|.|.|..:.|.
Mouse   356 LEDIRH---------------------AIA---------IDYDPVEGYIYWTDDEVRAIRRSFID 390

  Fly   140 GSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPTVERINLDGSNRTVIISSNIDMPRG 204
            ||.:..|   ::|:...|||:|||...|.||||::......|.|:|  |:.|.::||.:::.||.
Mouse   391 GSGSQFV---VTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN--GTMRKILISEDLEEPRA 450

  Fly   205 IVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVLKDKHHEPLNLAVTND--AIYWTDRTTRA 267
            ||:|.:...::|.|  .|....:|.:.||||||.|::......|..||:..|  .|||.|..|  
Mouse   451 IVLDPMVGYMYWTD--WGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKT-- 511

  Fly   268 VWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPEPVAEDCPLVRVANLSEEARGIVARTGFYQRLQ 332
                .|:.|:            :||.|..:   .:.||    ::.::          .||  .|.
Mouse   512 ----DKIEVM------------NTDGTGRR---VLVED----KIPHI----------FGF--TLL 541

  Fly   333 KDH-HCASIVRKVKERVDEQSRKFEIRSLLDQ-----------KIKVLEDERCMNDGE------- 378
            .|: :.....|:..|||.::|.:.|:  ::||           ..:::....|..|..       
Mouse   542 GDYVYWTDWQRRSIERVHKRSAEREV--IIDQLPDLMGLKATSVHRIIGSNPCAEDNGGCSHLCL 604

  Fly   379 YRAATDLCICPTGFK 393
            ||.....|.||.||:
Mouse   605 YRPQGLRCACPIGFE 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 TerD_like 48..>85 CDD:473128 8/45 (18%)
YvrE <73..>164 CDD:442613 22/90 (24%)
LY 101..141 CDD:214531 11/39 (28%)
Ldl_recept_b 167..208 CDD:459654 16/40 (40%)
LY 193..237 CDD:214531 15/43 (35%)
Lrp6NP_032540.2 YncE 1..204 CDD:442618
Beta-propeller 1 20..275
LY 89..127 CDD:214531
Ldl_recept_b 150..191 CDD:459654
LY 175..216 CDD:214531
LY 217..251 CDD:214531
LDL-receptor class B 5 236..277
FXa_inhibition 286..323 CDD:464251 5/31 (16%)
Beta-propeller 2 328..589 83/336 (25%)
LY 353..393 CDD:214531 14/69 (20%)
LY 397..437 CDD:214531 17/44 (39%)
Ldl_recept_b 458..499 CDD:459654 14/42 (33%)
LY 483..524 CDD:214531 15/58 (26%)
LY 525..558 CDD:214531 8/51 (16%)
FXa_inhibition 592..627 CDD:464251 9/28 (32%)
Beta-propeller 3 631..890
YncE <654..813 CDD:442618
LY 697..739 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:464251
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
YncE <968..1075 CDD:442618
Ldl_recept_b 1069..1110 CDD:459654
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:464251
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1556..1613
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.