DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and LDLRAD3

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_777562.1 Gene:LDLRAD3 / 143458 HGNCID:27046 Length:345 Species:Homo sapiens


Alignment Length:206 Identity:42/206 - (20%)
Similarity:64/206 - (31%) Gaps:79/206 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 TDLCICPTGFKGSRCEIRECHN-YCVHGTCQMSELAYPKCY--------------CQPGF----K 428
            |:.|..|..|.        |.| .|:.|..|...|  |.|:              |.|.|    .
Human    26 TNECNIPGNFM--------CSNGRCIPGAWQCDGL--PDCFDKSDEKECPKAKSKCGPTFFPCAS 80

  Fly   429 GERCELS--VCSGL--CLNGG-----------------HCRVSKDENEAPSCECPAKFGGARCEQ 472
            |..|.:.  .|:|.  |.:|.                 ||:.....:::..|:     |...|:.
Human    81 GIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFICD-----GQNNCQD 140

  Fly   473 NSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEV--CLTPRVWTSSVII 535
            ||.|                      ..||...:..|..:.:.....|..  .:|..:..||||.
Human   141 NSDE----------------------ESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIF 183

  Fly   536 ILVVGIVSSLL 546
            :|||.:::.:|
Human   184 VLVVALLALVL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
LDLRAD3NP_777562.1 LDLa 32..64 CDD:238060 10/41 (24%)
LDLa 71..106 CDD:238060 9/34 (26%)
LDLa 113..147 CDD:238060 8/60 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.