Sequence 1: | NP_612113.2 | Gene: | cue / 38174 | FlyBaseID: | FBgn0011204 | Length: | 644 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_777562.1 | Gene: | LDLRAD3 / 143458 | HGNCID: | 27046 | Length: | 345 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 42/206 - (20%) |
---|---|---|---|
Similarity: | 64/206 - (31%) | Gaps: | 79/206 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 383 TDLCICPTGFKGSRCEIRECHN-YCVHGTCQMSELAYPKCY--------------CQPGF----K 428
Fly 429 GERCELS--VCSGL--CLNGG-----------------HCRVSKDENEAPSCECPAKFGGARCEQ 472
Fly 473 NSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEV--CLTPRVWTSSVII 535
Fly 536 ILVVGIVSSLL 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cue | NP_612113.2 | LY | 101..141 | CDD:214531 | |
Ldl_recept_b | 167..208 | CDD:278487 | |||
LY | 193..237 | CDD:214531 | |||
LDLRAD3 | NP_777562.1 | LDLa | 32..64 | CDD:238060 | 10/41 (24%) |
LDLa | 71..106 | CDD:238060 | 9/34 (26%) | ||
LDLa | 113..147 | CDD:238060 | 8/60 (13%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 270..345 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |