DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cue and lrp3

DIOPT Version :9

Sequence 1:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_009301583.1 Gene:lrp3 / 100170796 ZFINID:ZDB-GENE-080116-3 Length:824 Species:Danio rerio


Alignment Length:328 Identity:69/328 - (21%)
Similarity:115/328 - (35%) Gaps:97/328 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 KPDEEDSTD-----STDFKDPEPVAEDCPL-------VRVAN-LSEEARGIVARTGFYQR----- 330
            :|:....||     ..|.|||:|:.....|       |||.: |.|:|..::.....:..     
Zfish   257 RPNRSTGTDLHCTWFLDTKDPKPLVLQVDLQLGVGDSVRVYDGLGEQAERLLQSLSHHNNHRRAL 321

  Fly   331 LQKDHHCASIVRKVKERVDEQ--SRKFEIRSLLDQKIKVLEDERCMNDGEYRAATDLCICPTGFK 393
            |:......||....|......  :..::::..            |. .||:...||        :
Zfish   322 LESSQGQMSIFYHAKPHSPGHGFNATYQVKGY------------CF-PGEHPCGTD--------E 365

  Fly   394 GSRCEIRECHNY--CVHGTCQMSELAYPKCYCQPGFKGERCE--LSVC---SGLCLNGGHCRVSK 451
            |...:::.|..|  |..|   ..|.|.|  .||||  ...||  ...|   |..|.|...|....
Zfish   366 GCYSDLQRCDGYWHCPGG---RDEEACP--LCQPG--EYPCEGGSGACYSASERCNNQKKCPDGS 423

  Fly   452 DENEAPSCECPAKFGGARCEQNSTEICSLFCRLLKHEPEMYVPFGC--HSICEELAQDNSTNIAI 514
            ||.....|: |..|   .|   .|.:|            ::..:.|  ...|.:.:.:.....::
Zfish   424 DEKNCFDCQ-PGNF---HC---GTNLC------------IFETWRCDGQEDCMDGSDERDCLASV 469

  Fly   515 PQYQHLEVCLTPRVWTSSVIIILVVGIVSSLLLVAV----IVQGIR----RLYKPKRPRIRKTFV 571
            |:          :|.|:::|..||.|:   ||::|:    .:..:|    |.::.:..|:...||
Zfish   470 PR----------KVITAALIGSLVCGL---LLVIALGCAFKLYSLRTREYRAFETQMTRLEAEFV 521

  Fly   572 VRK 574
            .|:
Zfish   522 QRE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
lrp3XP_009301583.1 CUB 31..141 CDD:238001
LDLa 151..185 CDD:238060
LDLa 197..234 CDD:238060
CUB 239..350 CDD:238001 19/92 (21%)
LDLa 354..389 CDD:238060 11/46 (24%)
LDLa 392..428 CDD:238060 13/37 (35%)
LDLa 431..465 CDD:238060 8/52 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.