DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and CG5213

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:162 Identity:33/162 - (20%)
Similarity:69/162 - (42%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ELKEDTIRVAFTPFGPIKSINMSWDPITQKHKG----FAFVEYEIPEGAQLALEQMNGALMGGRN 200
            ::.|..:...|:.||.|:...:    |..:..|    :.||:|.....|..|:..|:|....|:.
  Fly    51 DMTESELHRLFSKFGEIRKAKI----IRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKR 111

  Fly   201 IKV--GRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGPILYCKLAQGTS 263
            :||  .|||             |...:.:.:||.::...:.|:.::.:|..:|.|:...|.:...
  Fly   112 LKVAFARPS-------------EYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKF 163

  Fly   264 LHTHKGYGFIEYANKQAMDEAIASMNLFDLGG 295
            .:..:|..|:::...:..:.|...|:.:.:.|
  Fly   164 NNRSRGVAFLQFELVRDAEVAKYGMDRYMIEG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 33/162 (20%)
RRM1_PUF60 130..205 CDD:240816 17/70 (24%)
RRM2_PUF60 227..303 CDD:240817 12/69 (17%)
RRM3_UHM_PUF60 536..636 CDD:241092
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 17/69 (25%)
RRM 128..202 CDD:214636 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.