DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and CG1316

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:149 Identity:42/149 - (28%)
Similarity:78/149 - (52%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MCRVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNG 193
            |.|:::.......:|| .|.||:|:|.|:.|.:..|..||::||.|:|::.....|..|.|:|||
  Fly    27 MSRLFIICNKAHTEED-FREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNG 90

  Fly   194 ALMG--GRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGPILYC 256
            ..:|  .|.:||...:|..|..   ::.:.|.:.:.|:::. |....:||||:..|..:|.:...
  Fly    91 KTIGKMDRTLKVLVAANRNQGS---NKSENEQEKYVRLFIV-IPKTATEEDIREEFSQWGDVESV 151

  Fly   257 KLAQGTSLHTHKGYGFIEY 275
            .:.:..:....||:|::.:
  Fly   152 TIVKEKNNGNPKGFGYVRF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 42/149 (28%)
RRM1_PUF60 130..205 CDD:240816 27/76 (36%)
RRM2_PUF60 227..303 CDD:240817 11/49 (22%)
RRM3_UHM_PUF60 536..636 CDD:241092
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 28/78 (36%)
RRM2_RBM45 122..195 CDD:240813 11/50 (22%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.