DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and TBPH

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:61/154 - (39%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VLMKQTLAHQQQQLATQRTQVQRQQALALMCRVYVGSISFELKEDTIRVAFTPFGPIKSINMSWD 164
            |..|:........|.....:.:|.:.......:.|..:.::..|:::|..|..:|.:....:..|
  Fly    77 VFPKENKRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141

  Fly   165 PITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRI 229
            ..:.:.|||.||.:...:.....|  .|..|:.||..:|..|::.....||.          .::
  Fly   142 TKSGQSKGFGFVRFGSYDAQMRVL--TNRHLIDGRWCEVKVPNSKGMGHQVP----------CKV 194

  Fly   230 YVASIHPDLSEEDIKSVFEAFGPI 253
            :|.....|::.:|::..|..||.:
  Fly   195 FVGRCTEDINSDDLREYFSKFGEV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 30/154 (19%)
RRM1_PUF60 130..205 CDD:240816 17/74 (23%)
RRM2_PUF60 227..303 CDD:240817 6/27 (22%)
RRM3_UHM_PUF60 536..636 CDD:241092
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 18/77 (23%)
RRM2_TDP43 192..261 CDD:240768 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.