DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and TBPH

DIOPT Version :10

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:61/154 - (39%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VLMKQTLAHQQQQLATQRTQVQRQQALALMCRVYVGSISFELKEDTIRVAFTPFGPIKSINMSWD 164
            |..|:........|.....:.:|.:.......:.|..:.::..|:::|..|..:|.:....:..|
  Fly    77 VFPKENKRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141

  Fly   165 PITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRI 229
            ..:.:.|||.||.:...:.....|  .|..|:.||..:|..|::.....||.          .::
  Fly   142 TKSGQSKGFGFVRFGSYDAQMRVL--TNRHLIDGRWCEVKVPNSKGMGHQVP----------CKV 194

  Fly   230 YVASIHPDLSEEDIKSVFEAFGPI 253
            :|.....|::.:|::..|..||.:
  Fly   195 FVGRCTEDINSDDLREYFSKFGEV 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 30/154 (19%)