DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and Rbp9

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:470 Identity:105/470 - (22%)
Similarity:173/470 - (36%) Gaps:152/470 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKV-- 203
            :.:|.||..|..||.::|..:..|.:|.:..|:.||.|...|.|:.|:..:||..:..:.|||  
  Fly   121 MSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSI 185

  Fly   204 GRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGPILYCKLAQGTSLHTHK 268
            .|||:            |..|..| :||:.:..::::.|::|:|..:|.|:..::.........|
  Fly   186 ARPSS------------ESIKGAN-LYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSK 237

  Fly   269 GYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGRSITPPNALACPTT-----------NSTMPTA 322
            |.|||.:..:...|.||..:|             ..||.|:.. |.|           ||..|.|
  Fly   238 GVGFIRFDQRFEADRAIKELN-------------GTTPKNSTE-PITVKFANNPSSNKNSMQPLA 288

  Fly   323 AAVAAAAATAKIQALDAVASNAVLGLSQNTPVMAAGAVVTKVGAMPVVSAATSAAALHP------ 381
            |.:    |....:...|..:||           ||||           :||.:|||:||      
  Fly   289 AYI----APQNTRGGRAFPANA-----------AAGA-----------AAAAAAAAIHPNAGRYS 327

  Fly   382 -ALAQAAPA---LLPPGIFQAPT-----------PVAP--------SLLGVPAG-------LQPL 416
             .:::.:|.   |:..|:.|..|           .:||        .|.| |.|       ::.|
  Fly   328 SVISRYSPLTSDLITNGMIQGNTIASSGWCIFVYNLAPDTEENVLWQLFG-PFGAVQSVKVIRDL 391

  Fly   417 QA--------VVPTLPPPALLATPTLPMTVGGVGVG-----------------LVPTVATLAGAE 456
            |:        |..|....|:||..:|    .|..:|                 |:..:|.:..|.
  Fly   392 QSNKCKGFGFVTMTNYEEAVLAIQSL----NGYTLGNRVLQVSFKTNKNKQTXLLTKLAAVVNAN 452

  Fly   457 ASKGAAAAAAL-----------------SAAANNAAVTAANLSENIKKAHEKQQEELQKKLMD-- 502
            |:..|.||..|                 |..:|..:..|..|.:.:..:...:|..:.....:  
  Fly   453 AAAAALAANGLVLHNHHHHSNIGSINNNSNNSNGCSAAAFPLGKYVNHSSNNRQHNINNSTSNTS 517

  Fly   503 -EGDVQTLQQQENMS 516
             :....|..:|::|:
  Fly   518 KQKPASTSNKQQSMA 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 105/470 (22%)
RRM1_PUF60 130..205 CDD:240816 21/65 (32%)
RRM2_PUF60 227..303 CDD:240817 17/75 (23%)
RRM3_UHM_PUF60 536..636 CDD:241092
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 89/374 (24%)
RRM1_Hu 109..186 CDD:241094 21/64 (33%)
RRM2_Hu 196..274 CDD:241096 22/92 (24%)
RRM3_Hu 355..432 CDD:240823 16/81 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.