DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and ZK616.1

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001379953.1 Gene:ZK616.1 / 191358 WormBaseID:WBGene00022771 Length:251 Species:Caenorhabditis elegans


Alignment Length:296 Identity:70/296 - (23%)
Similarity:112/296 - (37%) Gaps:82/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RVYVGSISFELKEDTIRVAFT----PFGPIKSINMSWDPI---TQKHKGFAFVEYEIPEGAQLAL 188
            |:|||..|..|..:.||...|    ||      .:|.|.:   ::||:|||||:......|.:.|
 Worm    10 RLYVGGFSTNLSSEQIRNLITQLAAPF------EVSIDIVENGSRKHRGFAFVQCRSLAEANVLL 68

  Fly   189 EQMNGALMGGRNIKVGRPSNMPQ-AQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAFGP 252
            .:.:|..     .||......|: |:.|:..:       :.::|..|..|:.:.::   ::|||.
 Worm    69 AKFSGLF-----TKVNFAKKEPKPAENVMSNI-------SNVFVRGISRDMPDTEL---YQAFGG 118

  Fly   253 I----LYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLL--------RVGRSIT 305
            |    :.|        |...||||:.:..:....:.|..|:...|.|:|:        .|||...
 Worm   119 ITDGVVQC--------HVADGYGFVLFDTRANAQKKIVEMDGKTLNGKLISVSWARPDTVGRKRK 175

  Fly   306 PPNALACPTTNSTMPTAAAVAAAAATAKIQALDAVASNAVLGLSQNTPVMAAGAVVTKVGAMPVV 370
            .|.:...||.:||                          .||||.   ::....:.:.:..:|..
 Worm   176 RPMSEESPTPSST--------------------------DLGLSS---LLKRPVIPSHLFQLPPQ 211

  Fly   371 SAATSAAALHPALAQAAPALLPPGIFQAPTPVAPSL 406
            .|.....:|.|.|..:.|.|.|    |.|....|.|
 Worm   212 PAQILQPSLIPFLNPSFPLLFP----QNPLLAQPDL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 70/296 (24%)
RRM1_PUF60 130..205 CDD:240816 25/80 (31%)
RRM2_PUF60 227..303 CDD:240817 20/87 (23%)
RRM3_UHM_PUF60 536..636 CDD:241092
ZK616.1NP_001379953.1 hnRNP-R-Q <2..>220 CDD:273732 60/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.