DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfp and rad-26

DIOPT Version :9

Sequence 1:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_501545.1 Gene:rad-26 / 177706 WormBaseID:WBGene00007761 Length:1274 Species:Caenorhabditis elegans


Alignment Length:123 Identity:29/123 - (23%)
Similarity:55/123 - (44%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 LSENIKKAHEKQQEELQKKLMDEGDVQTLQQQE--NMSIKGQSARQLVMQRLMRPVDSRVIILRN 543
            :.||..|  |:|:||.:.::.::.:....||||  |:.|..|:.:.|..:.           ::.
 Worm     5 IDENTMK--EEQEEEERDEIEEKEEKPDAQQQELLNIRIPTQTKKSLKRKH-----------IKT 56

  Fly   544 MVGPEDVDETLQEEIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVEFSAGA 601
            ..|.||:||.:.|..:.|..:...:.::      :.||:...:.|.:      |.|||
 Worm    57 DFGAEDLDENVLEAQRLEKQRLERLEKI------KPENDHIQQMESL------FLAGA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfpNP_525123.2 half-pint 10..637 CDD:130706 29/123 (24%)
RRM1_PUF60 130..205 CDD:240816
RRM2_PUF60 227..303 CDD:240817
RRM3_UHM_PUF60 536..636 CDD:241092 14/66 (21%)
rad-26NP_501545.1 SNF2_N 259..629 CDD:278600
DEXDc 285..>398 CDD:238005
Helicase_C 778..904 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.056642 Normalized mean entropy S2096
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.