DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and Dynlrb1

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001278037.1 Gene:Dynlrb1 / 67068 MGIID:1914318 Length:104 Species:Mus musculus


Alignment Length:88 Identity:26/88 - (29%)
Similarity:50/88 - (56%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DNTNRITEQ--AQGFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCF 80
            :...|:..|  .||.:|....|..:..|..:.||.|  ..:|..:|:..|:|.||::|..:.|.|
Mouse    14 ETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQ--YANLMHNFILKARSTVREIDPQNDLTF 76

  Fly    81 LRVKTRKHEFLVSPEEAFTVTVV 103
            ||::::|:|.:|:|::.:.:.|:
Mouse    77 LRIRSKKNEIMVAPDKDYFLIVI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 24/80 (30%)
Dynlrb1NP_001278037.1 Robl_LC7 12..99 CDD:214939 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.