powered by:
Protein Alignment robl62A and dynlrb2
DIOPT Version :9
Sequence 1: | NP_001261256.1 |
Gene: | robl62A / 38170 |
FlyBaseID: | FBgn0028567 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031755935.1 |
Gene: | dynlrb2 / 549149 |
XenbaseID: | XB-GENE-491537 |
Length: | 120 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 24/69 - (34%) |
Similarity: | 42/69 - (60%) |
Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 NAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFT 99
||....:.|:.|.:|.......||...:| |:|.|||:|..:.|.|||::::|||.:|:|::.:.
Frog 48 NAEGIPIRTTLDNSTTVQYAGLLHQLSMK-AKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYL 111
Fly 100 VTVV 103
:.|:
Frog 112 LIVI 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1512428at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.