DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and dynlrb2

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_031755935.1 Gene:dynlrb2 / 549149 XenbaseID:XB-GENE-491537 Length:120 Species:Xenopus tropicalis


Alignment Length:69 Identity:24/69 - (34%)
Similarity:42/69 - (60%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFT 99
            ||....:.|:.|.:|.......||...:| |:|.|||:|..:.|.|||::::|||.:|:|::.:.
 Frog    48 NAEGIPIRTTLDNSTTVQYAGLLHQLSMK-AKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYL 111

  Fly   100 VTVV 103
            :.|:
 Frog   112 LIVI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 23/67 (34%)
dynlrb2XP_031755935.1 Robl_LC7 27..117 CDD:397386 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.