DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and dynlrb1

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_957482.1 Gene:dynlrb1 / 394163 ZFINID:ZDB-GENE-040426-989 Length:96 Species:Danio rerio


Alignment Length:88 Identity:25/88 - (28%)
Similarity:50/88 - (56%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DNTNRITEQ--AQGFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCF 80
            :...||..|  .||.:: .||....:.::.|.|:......::|...:| |:..|||:|..:.|.|
Zfish     6 ETIKRIQSQKGVQGIII-VNAEGIPIKSTLDNTSTVQYAANIHQLLMK-ARGIVRDIDPQNDLTF 68

  Fly    81 LRVKTRKHEFLVSPEEAFTVTVV 103
            |||:::|:|.:::|::.:.:.|:
Zfish    69 LRVRSKKNEIMIAPDKDYFLIVI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 22/80 (28%)
dynlrb1NP_957482.1 Robl_LC7 5..93 CDD:281277 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.