powered by:
Protein Alignment robl62A and CG16837
DIOPT Version :9
Sequence 1: | NP_001261256.1 |
Gene: | robl62A / 38170 |
FlyBaseID: | FBgn0028567 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611916.1 |
Gene: | CG16837 / 37904 |
FlyBaseID: | FBgn0035009 |
Length: | 130 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 25/42 - (59%) |
Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 LKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFTVTVV 103
|.:|::.|||||..:.:.|:|:::...|..::....|.:.||
Fly 77 LFMARNVVRDLDPSNDITFMRIRSNMGEIHMTLGTDFILIVV 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4115 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2020 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1512428at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10779 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.870 |
|
Return to query results.
Submit another query.